ATOX1 monoclonal antibody (M08), clone 4D6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant ATOX1.
Immunogen
ATOX1 (NP_004036, 1 a.a. ~ 68 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MPKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLGLE
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (88); Rat (89)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (33.22 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
ATOX1 monoclonal antibody (M08), clone 4D6. Western Blot analysis of ATOX1 expression in human spleen.Western Blot (Cell lysate)
ATOX1 monoclonal antibody (M08), clone 4D6. Western Blot analysis of ATOX1 expression in COLO 320 HSR ( Cat # L020V1 ).Western Blot (Cell lysate)
ATOX1 monoclonal antibody (M08), clone 4D6. Western Blot analysis of ATOX1 expression in HepG2 ( Cat # L019V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ATOX1 is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — ATOX1
Entrez GeneID
475GeneBank Accession#
NM_004045Protein Accession#
NP_004036Gene Name
ATOX1
Gene Alias
ATX1, HAH1, MGC138453, MGC138455
Gene Description
ATX1 antioxidant protein 1 homolog (yeast)
Omim ID
602270Gene Ontology
HyperlinkGene Summary
This gene encodes a copper chaperone that plays a role in copper homeostasis by binding and transporting cytosolic copper to ATPase proteins in the trans-Golgi network for later incorporation to the ceruloplasmin. This protein also functions as an antioxidant against superoxide and hydrogen peroxide, and therefore, may play a significant role in cancer carcinogenesis. Because of its cytogenetic location, this gene represents a candidate gene for 5q-syndrome. [provided by RefSeq
Other Designations
antioxidant protein 1|copper transport protein|metal transport protein
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com