AKT2 monoclonal antibody (M03), clone 1D9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant AKT2.
Immunogen
AKT2 (AAA58364, 100 a.a. ~ 189 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MRAIQMVANSLKQRAPGEDPMDYKCGSPSDSSTTEEMEVAVSKARAKVTMNDFDYLKLLGKGTFGKVILVREKATGRYYAMKILRKEVII
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (94); Rat (94)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.53 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
AKT2 monoclonal antibody (M03), clone 1D9. Western Blot analysis of AKT2 expression in NIH/3T3(Cat # L018V1 ).Western Blot (Cell lysate)
AKT2 monoclonal antibody (M03), clone 1D9. Western Blot analysis of AKT2 expression in Raw 264.7(Cat # L024V1 ).Western Blot (Cell lysate)
AKT2 monoclonal antibody (M03), clone 1D9 Western Blot analysis of AKT2 expression in Jurkat ( Cat # L017V1 ).Western Blot (Cell lysate)
AKT2 monoclonal antibody (M03), clone 1D9. Western Blot analysis of AKT2 expression in PC-12(Cat # L012V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged AKT2 is approximately 1ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to AKT2 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — AKT2
Entrez GeneID
208GeneBank Accession#
M95936Protein Accession#
AAA58364Gene Name
AKT2
Gene Alias
PKBB, PKBBETA, PRKBB, RAC-BETA
Gene Description
v-akt murine thymoma viral oncogene homolog 2
Gene Ontology
HyperlinkGene Summary
This gene is a putative oncogene encoding a protein belonging to a subfamily of serine/threonine kinases containing SH2-like (Src homology 2-like) domains. The gene was shown to be amplified and overexpressed in 2 of 8 ovarian carcinoma cell lines and 2 of 15 primary ovarian tumors. Overexpression contributes to the malignant phenotype of a subset of human ductal pancreatic cancers. The encoded protein is a general protein kinase capable of phophorylating several known proteins. [provided by RefSeq
Other Designations
Murine thymoma viral (v-akt) homolog-2|rac protein kinase beta
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Multiple defects in negative regulation of the PKB/Akt pathway sensitise human cancer cells to the antiproliferative effect of non-steroidal anti-inflammatory drugs.
Lincová E, Hampl A, Pernicová Z, Starsíchová A, Krcmár P, Machala M, Kozubík A, Soucek K.
Biochemical Pharmacology 2009 Sep; 78(6):561.
Application:IF, WB-Tr, Human, HCT-116, LNCaP, PC-3 cells.
-
Multiple defects in negative regulation of the PKB/Akt pathway sensitise human cancer cells to the antiproliferative effect of non-steroidal anti-inflammatory drugs.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com