ALOX15 monoclonal antibody (M04), clone 3D8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant ALOX15.
Immunogen
ALOX15 (AAH29032, 1 a.a. ~ 662 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MGLYRIRVSTGASLYAGSNNQVQLWLVGQHGEAALGKRLWPARGKETELKVEVPEYLGPLLFVKLRKRHLLKDDAWFCNWISVQGPGAGDEVRFPCYRWVEGNGVLSLPEGTGRTVGEDPQGLFQKHREEELEERRKLYRWGNWKDGLILNMAGAKLYDLPVDERFLEDKRVDFEVSLAKGLADLAIKDSLNVLTCWKDLDDFNRIFWCGQSKLAERVRDSWKEDALFGYQFLNGANPVVLRRSAHLPARLVFPPGMEELQAQLEKELEGGTLFEADFSLLDGIKANVILCSQQHLAAPLVMLKLQPDGKLLPMVIQLQLPRTGSPPPPLFLPTDPPMAWLLAKCWVRSSDFQLHELQSHLLRGHLMAEVIVVATMRCLPSIHPIFKLIIPHLRYTLEINVRARTGLVSDMGIFDQIMSTGGGGHVQLLKQAGAFLTYSSFCPPDDLADRGLLGVKSSFYPQDALRLWEIIYRYVEGIVSLHYKTDVAVKDDPELQTWCREITEIGLQGAQDRGFPVSLQARDQVCHFVTMCIFTCTGQHASVHLGQLDWYSWVPNAPCTMRLPPPTTKDATLETVMATLPNFHQASLQMSITWQLGRRQPVMVAVGQHEEEYFSGPEPKAVLKKFREELAALDKEIEIRNAKLDMPYEYLRPSVVENSVAI
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (73); Rat (74)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (98.56 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
ALOX15 monoclonal antibody (M04), clone 3D8 Western Blot analysis of ALOX15 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to ALOX15 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 1.5 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ALOX15 is approximately 3ng/ml as a capture antibody.ELISA
-
Gene Info — ALOX15
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Expression and localization of prostaglandin receptors and stromal factors in human cervix-Variations in pregnant and non-pregnant states.
Blesson CS, Roos N, Stephansson O, Masironi B, Reinert S, Stjernholm YV, Ekman-Ordeberg G, Sahlin L.
Open Journal of Molecular and Integrative Physiology 2013 Nov; 3:147.
Application:IHC, Human, Cervical.
-
Systematic analysis of rat 12/15-lipoxygenase enzymes reveals critical role for spinal eLOX3 hepoxilin synthase activity in inflammatory hyperalgesia.
Gregus AM, Dumlao DS, Wei SC, Norris PC, Catella LC, Meyerstein FG, Buczynski MW, Steinauer JJ, Fitzsimmons BL, Yaksh TL, Dennis EA.
The FASEB Journal 2013 May; 27(5):1939.
Application:WB, Rat, rat spinal cord.
-
Differential Expression and Localization of 12/15 Lipoxygenases in Adipose Tissue in Human Obese Subjects.
Dobrian AD, Lieb DC, Ma Q, Lindsay JW, Cole BK, Ma K, Chakrabarti SK, Kuhn NS, Wohlgemuth SD, Fontana M, Nadler JL.
Biochemical and Biophysical Research Communications 2010 Dec; 403(3-4):485.
Application:IHC-P, Human, Adipose tissue.
-
Selective survival rescue in 15-lipoxygenase-1 deficient retinal pigment epithelial cells by the novel docosahexaenoic acid-derived mediator, neuroprotectin D1.
Calandria JM, Marcheselli VL, Mukherjee PK, Uddin J, Winkler JW, Petasis NA, Bazan NG.
The Journal of Biological Chemistry 2009 Jun; 284(26):17877.
Application:IF, WB, Human, ARPE-19 cells.
-
Expression and localization of prostaglandin receptors and stromal factors in human cervix-Variations in pregnant and non-pregnant states.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com