CCL5 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specifications
Product Description
Human CCL5 full-length ORF ( AAH08600, 1 a.a. - 91 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MKVSAAALAVILIATALCAPASASPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
35.75
Interspecies Antigen Sequence
Mouse (80); Rat (79)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — CCL5
Entrez GeneID
6352GeneBank Accession#
BC008600Protein Accession#
AAH08600Gene Name
CCL5
Gene Alias
D17S136E, MGC17164, RANTES, SCYA5, SISd, TCP228
Gene Description
chemokine (C-C motif) ligand 5
Omim ID
187011Gene Ontology
HyperlinkGene Summary
This gene is one of several CC cytokine genes clustered on the q-arm of chromosome 17. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene functions as a chemoattractant for blood monocytes, memory T helper cells and eosinophils. It causes the release of histamine from basophils and activates eosinophils. This cytokine is one of the major HIV-suppressive factors produced by CD8+ cells. It functions as one of the natural ligands for the chemokine receptor CCR5 and it suppresses in vitro replication of the R5 strains of HIV-1, which use CCR5 as a coreceptor. [provided by RefSeq
Other Designations
SIS-delta|T-cell specific RANTES protein|T-cell specific protein p288|beta-chemokine RANTES|regulated upon activation, normally T-expressed, and presumably secreted|small inducible cytokine A5|small inducible cytokine A5 (RANTES)|small inducible cytokine
-
Interactomes
-
Pathways
-
Diseases
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com