ACY1 monoclonal antibody (M01), clone 4F1-B7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specifications
Product Description
Mouse monoclonal antibody raised against a full length recombinant ACY1.
Immunogen
ACY1 (AAH00545, 1 a.a. ~ 408 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MTSKGPAEEHPSVTLFRQYLRIRTVQPKPDYGAAVAFFEETARQLGLGCQKVEVAPGYVVTVLTWPGTNPTLSSILLNSHTDVVPVFKEHWSHDPFEAFKDSEGYIYARGAQDVKCVSIQYLEAVRRLKVEGHRFPRTIHMTFVPDEEVGGHQGMELFVQRPEFHALRAGFALDEGIANPTDAFTVFYSERSPWWVRVTSTGRPGHASRFMEDTAAEKLHKVVNSILAFREKEWQRLQSNPHLKEGSVTSVNLTKLEGGVAYNVIPATMSASFDFRVAPDVDFKAFEEQLQSWCQAAGEGVTLEFAQKWMHPQVTPTDDSNPWWAAFSRVCKDMNLTLEPEIMPAATDNRYIRAVGVPALGFSPMNRTPVLLHDHDERLHEAVFLRGVDIYTRLLPALASVPALPSDS
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (85); Rat (87)
Isotype
IgG1 kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (70.62 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
ACY1 monoclonal antibody (M01), clone 4F1-B7. Western Blot analysis of ACY1 expression in K-562 ( Cat # L009V1 ).Western Blot (Transfected lysate)
Western Blot analysis of ACY1 expression in transfected 293T cell line by ACY1 monoclonal antibody (M01), clone 4F1-B7.
Lane 1: ACY1 transfected lysate(45.9 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to ACY1 on formalin-fixed paraffin-embedded human malignant lymphoma, diffuse large B tissue. [antibody concentration 3 ug/ml]Immunoprecipitation
Immunoprecipitation of ACY1 transfected lysate using anti-ACY1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with ACY1 MaxPab rabbit polyclonal antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to ACY1 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — ACY1
Entrez GeneID
95GeneBank Accession#
BC000545Protein Accession#
AAH00545Gene Name
ACY1
Gene Alias
ACY1D, ACYLASE
Gene Description
aminoacylase 1
Gene Ontology
HyperlinkGene Summary
Aminoacylase-1 is a cytosolic, homodimeric, zinc-binding enzyme that catalyzes the hydrolysis of acylated L-amino acids to L-amino acids and acyl group, and has been postulated to function in the catabolism and salvage of acylated amino acids. ACY1 has been assigned to chromosome 3p21.1, a region reduced to homozygosity in small-cell lung cancer (SCLC), and its expression has been reported to be reduced or undetectable in SCLC cell lines and tumors. The amino acid sequence of human aminoacylase-1 is highly homologous to the porcine counterpart, and ACY1 is the first member of a new family of zinc-binding enzymes. [provided by RefSeq
Other Designations
-
-
Interactomes
-
Pathways
-
Publication Reference
-
Prodefensin-A6 Assay Method for The In Vitro Diagnosis of Colorectal Cancer.
Yasemin Ataman-Önal, Corinne Beaulieu, Sandrine Busseret, Jean-Philippe Charrier, Geneviève Choquet-Kastylevsky, Dominique Rolland.
United States Patent Application Publication 2012 May; [Epub].
Application:ELISA, Human, Serum.
-
Profiling of antibody production against xenograft-released proteins by protein microarrays discovers prostate cancer markers.
Jansen FH, Rijswijk A, Teubel W, Weerden WM, Reneman S, Bemd GJ, Roobol MJ, Bangma CH, Staal FJ, Jenster G.
Journal of Proteome Research 2012 Feb; 11(2):728.
Application:ELISA, Human, Serum.
-
Prodefensin-A6 Assay Method for The In Vitro Diagnosis of Colorectal Cancer.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com