UCHL3 monoclonal antibody (M01), clone 4E9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
UCHL3 monoclonal antibody (M01), clone 4E9. Western Blot analysis of UCHL3 expression in PC-12 ( Cat # L012V1 ).
Western Blot (Cell lysate)
UCHL3 monoclonal antibody (M01), clone 4E9 Western Blot analysis of UCHL3 expression in K-562 ( Cat # L009V1 ).
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged UCHL3 is approximately 0.03ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.74 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant UCHL3.
Immunogen
UCHL3 (NP_005993, 131 a.a. ~ 230 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
PEERARYLENYDAIRVTHETSAHEGQTEAPSIDEKVDLHFIALVHVDGHLYELDGRKPFPINHGETSDETLLEDAIEVCKKFMERDPDELRFNAIALSAA
Host
Mouse
Reactivity
Human, Rat
Interspecies Antigen Sequence
Mouse (97); Rat (98)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
UCHL3 monoclonal antibody (M01), clone 4E9. Western Blot analysis of UCHL3 expression in PC-12 ( Cat # L012V1 ).Western Blot (Cell lysate)
UCHL3 monoclonal antibody (M01), clone 4E9 Western Blot analysis of UCHL3 expression in K-562 ( Cat # L009V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged UCHL3 is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — UCHL3
Entrez GeneID
7347GeneBank Accession#
NM_006002Protein Accession#
NP_005993Gene Name
UCHL3
Gene Alias
UCH-L3
Gene Description
ubiquitin carboxyl-terminal esterase L3 (ubiquitin thiolesterase)
Omim ID
603090Gene Ontology
HyperlinkOther Designations
OTTHUMP00000018509|ubiquitin carboxyl-terminal esterase L3|ubiquitin thiolesterase
-
Interactome
-
Publication Reference
-
Proteomic analysis of the effects of the immunomodulatory mycotoxin deoxynivalenol.
da Costa AN, Mijal RS, Keen JN, Findlay JB, Wild CP.
Proteomics 2011 May; 11(10):1903.
Application：Flow Cyt, Human, RPMI 1788, Jurkat E6.1 cells.
-
Proteomic analysis of the effects of the immunomodulatory mycotoxin deoxynivalenol.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com