AFP monoclonal antibody (M01), clone 1G7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant AFP.
Immunogen
AFP (AAH27881, 500 a.a. ~ 609 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
CCTSSYANRRPCFSSLVVDETYVPPAFSDDKFIFHKDLCQAQGVALQTMKQEFLINLVKQKPQITEEQLEAVIADFSGLLEKCCQGQEQEVCFAEEGQKLISKTRAALGV
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (79); Rat (78)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
AFP monoclonal antibody (M01), clone 1G7 Western Blot analysis of AFP expression in HepG2 ( Cat # L019V1 ).Western Blot (Transfected lysate)
Western Blot analysis of AFP expression in transfected 293T cell line by AFP monoclonal antibody (M01), clone 1G7.
Lane 1: AFP transfected lysate(69 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunoprecipitation
Immunoprecipitation of AFP transfected lysate using anti-AFP monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with AFP MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged AFP is approximately 0.03ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to AFP on HepG2 cell . [antibody concentration 30 ug/ml] -
Gene Info — AFP
Entrez GeneID
174GeneBank Accession#
BC027881Protein Accession#
AAH27881Gene Name
AFP
Gene Alias
FETA, HPAFP
Gene Description
alpha-fetoprotein
Omim ID
104150Gene Ontology
HyperlinkGene Summary
This gene encodes alpha-fetoprotein, a major plasma protein produced by the yolk sac and the liver during fetal life. Alpha-fetoprotein expression in adults is often associated with hepatoma or teratoma. However, hereditary persistance of alpha-fetoprotein may also be found in individuals with no obvious pathology. The protein is thought to be the fetal counterpart of serum albumin, and the alpha-fetoprotein and albumin genes are present in tandem in the same transcriptional orientation on chromosome 4. Alpha-fetoprotein is found in monomeric as well as dimeric and trimeric forms, and binds copper, nickel, fatty acids and bilirubin. The level of alpha-fetoprotein in amniotic fluid is used to measure renal loss of protein to screen for spina bifida and anencephaly. [provided by RefSeq
Other Designations
OTTHUMP00000160480|alpha-1-fetoprotein|alpha-fetoglobulin
-
Interactome
-
Disease
-
Publication Reference
-
Derivation of porcine extraembryonic endoderm-like cells from blastocysts.
Li Y, Wu S, Yu Y, Zhang H, Wei R, Lv J, Cai M, Yang X, Zhang Y, Liu Z.
Cell proliferation 2020 Apr; 53(4):e12782.
Application:IF, Pig, pXEN-like cells.
-
A magneto-microfluidic platform for fluorescence immunosensing using quantum dot nanoparticles.
Tsai HY, Wu HH, Chou BC, Li CS, Gau BZ, Lin ZY, Fuh CB.
Nanotechnology 2019 Dec; 30(50):505101.
Application:Magnetic immunoassay, Recombinant protein.
-
Human induced pluripotent stem cell line HMUi001-A derived from corneal stromal cells.
Bikkuzin T, Shi Y, Sun B, Guo Y, Jin X, Han Z, Pavlov V, Zhang H.
Stem Cell Research 2019 May; 37:101409.
Application:ICC, IF, Human, Human induced pluripotent stem cell line HMUi001-A.
-
Magnetofluorescent nanocomposites and quantum dots used for optimal application in magnetic fluorescence-linked immunoassay.
Tsai HY, Li SY, Fuh CB.
Analytical and Bioanalytical Chemistry 2018 Mar; 410(7):1923.
Application:ELISA, Serum samples.
-
Multifunctional Nanoparticles for Protein Detections in Thin Channels.
Hweiyan Tsai, Weimin Lin, Mingchieh Chuang, Yishuan Lu, C Bor Fuh.
Biosensors & Bioelectronics 2017 Apr; 90:153.
Application:ELISA, Human, Human serum, Recombinant protein.
-
A single-step enzyme immunoassay capillary sensor composed of functional multilayer coatings for diagnosis marker proteins.
Funano SI, Sugahara M, Henares TG, Sueyoshi K, Endo T, Hisamoto H.
Analyst 2015 Mar; 140(5):1459.
Application:EIA, Recombinant protein.
-
Immunodevice for simultaneous detection of two relevant tumor markers based on separation of different microparticles by dielectrophoresis.
Ramón-Azcón J, Yasukawa T, Mizutani F.
Biosensors & Bioelectronics 2011 Oct; 28(1):443.
Application:Func, Particles.
-
Derivation of porcine extraembryonic endoderm-like cells from blastocysts.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com