PPIF (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specifications
Product Description
Human PPIF full-length ORF ( NP_005720.1, 1 a.a. - 207 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MLALRCGSRWLGLLSVPRSVPLRLPAARACSKGSGDPSSSSSSGNPLVYLDVDANGKPLGRVVLELKADVVPKTAENFRALCTGEKGFGYKGSTFHRVIPSFMCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVLSMANAGPNTNGSQFFICTIKTDWLDGKHVVFGHVKEGMDVVKKIESFGSKSGRTSKKIVITDCGQLS
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
48.4
Interspecies Antigen Sequence
Mouse (89); Rat (89)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — PPIF
Entrez GeneID
10105GeneBank Accession#
NM_005729.3Protein Accession#
NP_005720.1Gene Name
PPIF
Gene Alias
CYP3, Cyp-D, FLJ90798, MGC117207
Gene Description
peptidylprolyl isomerase F
Omim ID
604486Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein is part of the mitochondrial permeability transition pore in the inner mitochondrial membrane. Activation of this pore is thought to be involved in the induction of apoptotic and necrotic cell death. [provided by RefSeq
Other Designations
OTTHUMP00000019925|PPIase|cyclophilin 3|cyclophilin D|cyclophilin F|peptidyl-prolyl cis-trans isomerase, mitochondral|rotamase
-
Interactomes
-
Diseases
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com