MIF monoclonal antibody (M01), clone 2A10-4D3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant MIF.
Immunogen
MIF (AAH00447.1, 1 a.a. ~ 115 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (90); Rat (90)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (38.39 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
MIF monoclonal antibody (M01), clone 2A10-4D3. Western Blot analysis of MIF expression in HepG2.Western Blot (Cell lysate)
MIF monoclonal antibody (M01), clone 2A10-4D3. Western Blot analysis of MIF expression in A-549.Western Blot (Cell lysate)
MIF monoclonal antibody (M01), clone 2A10-4D3. Western Blot analysis of MIF expression in HeLa.Western Blot (Transfected lysate)
Western Blot analysis of MIF expression in transfected 293T cell line by MIF monoclonal antibody (M01), clone 2A10-4D3.
Lane 1: MIF transfected lysate(12.5 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to MIF on formalin-fixed paraffin-embedded human lung, adenosquamous cell carcinoma tissue. [antibody concentration 1 ~ 10 ug/ml]Immunoprecipitation
Immunoprecipitation of MIF transfected lysate using anti-MIF monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with MIF MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged MIF is approximately 0.1ng/ml as a capture antibody.ELISA
-
Gene Info — MIF
Entrez GeneID
4282GeneBank Accession#
BC000447Protein Accession#
AAH00447.1Gene Name
MIF
Gene Alias
GIF, GLIF, MMIF
Gene Description
macrophage migration inhibitory factor (glycosylation-inhibiting factor)
Gene Ontology
HyperlinkGene Summary
This gene encodes a lymphokine involved in cell-mediated immunity, immunoregulation, and inflammation. It plays a role in the regulation of macrophage function in host defense through the suppression of anti-inflammatory effects of glucocorticoids. This lymphokine and the JAB1 protein form a complex in the cytosol near the peripheral plasma membrane, which may indicate an additional role in integrin signaling pathways. [provided by RefSeq
Other Designations
glycosylation-inhibiting factor|phenylpyruvate tautomerase
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Evaluating Macrophage Migration Inhibitory Factor 1 Expression as a Prognostic Biomarker in Colon Cancer.
Lina Olsson, Gudrun Lindmark, Marie-Louise Hammarström, Sten Hammarström, Basel Sitohy.
Tumour Biology : the Journal of the International Society for Oncodevelopmental Biology and Medicine 2020 Jun; 42(6):1010428320.
Application:IHC, IF, Human, Colon cancer.
-
An HLA-Presented Fragment of Macrophage Migration Inhibitory Factor Is a Therapeutic Target for Invasive Breast Cancer.
Hawkins O, Verma B, Lightfoot S, Jain R, Rawat A, McNair S, Caseltine S, Mojsilovic A, Gupta P, Neethling F, Almanza O, Dooley W, Hildebrand W, Weidanz J.
Journal of Immunology 2011 Jun; 186(11):6607.
Application:IHC-Fr, Human, BT-20-A2, MCF10A, MDA-MB-231 cells, Human breast cancer.
-
eIF3m expression influences the regulation of tumorigenesis-related genes in human colon cancer.
Goh SH, Hong SH, Hong SH, Lee BC, Ju MH, Jeong JS, Cho YR, Kim IH, Lee YS.
Oncogene 2011 Jan; 30(4):398.
Application:WB-Tr, Human, HCT-116 cells.
-
Evaluating Macrophage Migration Inhibitory Factor 1 Expression as a Prognostic Biomarker in Colon Cancer.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com