IL13RA2 monoclonal antibody (M01J), clone 2E10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant IL13RA2.
This product is belong to Cell Culture Grade Antibody (CX Grade).Immunogen
IL13RA2 (NP_000631, 27 a.a. ~ 126 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
DTEIKVNPPQDFEIVDPGYLGYLYLQWQPPLSLDHFKECTVEYELKYRNIGSETWKTIITKNLHYKDGFDLNKGIEAKIHTLLPWQCTNGSEVQSSWAET
Host
Mouse
Reactivity
Human
Preparation Method
Cell Culture Production
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
IL13RA2 monoclonal antibody (M01J), clone 2E10. Western Blot analysis of IL13RA2 expression in HeLa.Western Blot (Transfected lysate)
Western Blot analysis of IL13RA2 expression in transfected 293T cell line by IL13RA2 monoclonal antibody (M01J), clone 2E10.
Lane 1: IL13RA2 transfected lysate (Predicted MW: 44.2 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged IL13RA2 is 0.3 ng/ml as a capture antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged IL13RA2 is 0.03 ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of IL13RA2 over-expressed 293 cell line, cotransfected with IL13RA2 Validated Chimera RNAi ( Cat # H00003598-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with IL13RA2 monoclonal antibody (M01), clone 2E10 (Cat # H00003598-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — IL13RA2
Entrez GeneID
3598GeneBank Accession#
NM_000640Protein Accession#
NP_000631Gene Name
IL13RA2
Gene Alias
CD213A2, IL-13R, IL13BP
Gene Description
interleukin 13 receptor, alpha 2
Omim ID
300130Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is closely related to Il13RA1, a subuint of the interleukin 13 receptor complex. This protein binds IL13 with high affinity, but lacks cytoplasmic domain, and does not appear to function as a signal mediator. It is reported to play a role in the internalization of IL13. [provided by RefSeq
Other Designations
IL-13 receptor|OTTHUMP00000023871|interleukin 13 binding protein|interleukin 13 receptor alpha 2 chain
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com