CXCR3 monoclonal antibody (M01), clone 1C5

Catalog # H00002833-M01

Size

Price

Stock

Quantity

Size:100 ug
Price: USD $ 335.00
Stock:
order now, ship next day
abnova-minus
abnova-plus

* The price is valid only in USA. Please select country.

Contact Info
  • +1-909-264-1399
    +1-909-992-0619
    Toll Free : +1-877-853-6098
  • +1-909-992-3401
Images
Western Blot (Cell lysate)
Application

Western Blot (Cell lysate)

CXCR3 monoclonal antibody (M01), clone 1C5. Western Blot analysis of CXCR3 expression in HeLa.

Western Blot (Cell lysate)
Application

Western Blot (Cell lysate)

CXCR3 monoclonal antibody (M01), clone 1C5. Western Blot analysis of CXCR3 expression in Jurkat.

QC Test

Western Blot detection against Immunogen (31.57 KDa) .

  • Specification

    Product Description

    Mouse monoclonal antibody raised against a partial recombinant CXCR3.

    Immunogen

    CXCR3 (NP_001495.1, 1 a.a. ~ 53 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

    Sequence

    MVLEVSDHQVLNDAEVAALLENFSSSYDYGENESDSCCTSPPCPQDFSLNFDR

    Host

    Mouse

    Reactivity

    Human

    Isotype

    IgM Kappa

    Quality Control Testing

    Antibody Reactive Against Recombinant Protein.

    Western Blot detection against Immunogen (31.57 KDa) .

    Storage Buffer

    In 1x PBS, pH 7.4

    Storage Instruction

    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

  • Applications

    Western Blot (Cell lysate)

    CXCR3 monoclonal antibody (M01), clone 1C5. Western Blot analysis of CXCR3 expression in HeLa.

    Western Blot (Cell lysate)

    CXCR3 monoclonal antibody (M01), clone 1C5. Western Blot analysis of CXCR3 expression in Jurkat.

    Western Blot (Recombinant protein)

    ELISA

  • Gene Info — CXCR3

    Entrez GeneID

    2833

    GeneBank Accession#

    NM_001504

    Protein Accession#

    NP_001495.1

    Gene Name

    CXCR3

    Gene Alias

    CD182, CD183, CKR-L2, CMKAR3, GPR9, IP10-R, Mig-R, MigR

    Gene Description

    chemokine (C-X-C motif) receptor 3

    Omim ID

    300574

    Gene Ontology

    Hyperlink

    Gene Summary

    This gene encodes a G protein-coupled receptor with selectivity for three chemokines, termed IP10 (interferon-g-inducible 10 kDa protein), Mig (monokine induced by interferon-g) and I-TAC (interferon-inducible T cell a-chemoattractant). IP10, Mig and I-TAC belong to the structural subfamily of CXC chemokines, in which a single amino acid residue separates the first two of four highly conserved Cys residues. Binding of chemokines to this protein induces cellular responses that are involved in leukocyte traffic, most notably integrin activation, cytoskeletal changes and chemotactic migration. Inhibition by Bordetella pertussis toxin suggests that heterotrimeric G protein of the Gi-subclass couple to this protein. Signal transduction has not been further analyzed but may include the same enzymes that were identified in the signaling cascade induced by other chemokine receptors. As a consequence of chemokine-induced cellular desensitization (phosphorylation-dependent receptor internalization), cellular responses are typically rapid and short in duration. Cellular responsiveness is restored after dephosphorylation of intracellular receptors and subsequent recycling to the cell surface. This gene is prominently expressed in in vitro cultured effector/memory T cells, and in T cells present in many types of inflamed tissues. In addition, IP10, Mig and I-TAC are commonly produced by local cells in inflammatory lesion, suggesting that this gene and its chemokines participate in the recruitment of inflammatory cells. Therefore, this protein is a target for the development of small molecular weight antagonists, which may be used in the treatment of diverse inflammatory diseases. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

    Other Designations

    G protein-coupled receptor 9|IP10 receptor|Mig receptor|OTTHUMP00000070257|chemokine (C-X-C) receptor 3

  • Interactome
  • Pathway
  • Disease
Contact Info
  • +1-909-264-1399
    +1-909-992-0619
    Toll Free : +1-877-853-6098
  • +1-909-992-3401
4 Products to Compare
Remove All