FAS monoclonal antibody (M02), clone 1D6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant FAS.
Immunogen
FAS (NP_000034, 20 a.a. ~ 119 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
SKSVNAQVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCRLCDEGHGLEVEINC
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged FAS is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — FAS
Entrez GeneID
355GeneBank Accession#
NM_000043Protein Accession#
NP_000034Gene Name
FAS
Gene Alias
ALPS1A, APO-1, APT1, CD95, FAS1, FASTM, TNFRSF6
Gene Description
Fas (TNF receptor superfamily, member 6)
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor contains a death domain. It has been shown to play a central role in the physiological regulation of programmed cell death, and has been implicated in the pathogenesis of various malignancies and diseases of the immune system. The interaction of this receptor with its ligand allows the formation of a death-inducing signaling complex that includes Fas-associated death domain protein (FADD), caspase 8, and caspase 10. The autoproteolytic processing of the caspases in the complex triggers a downstream caspase cascade, and leads to apoptosis. This receptor has been also shown to activate NF-kappaB, MAPK3/ERK1, and MAPK8/JNK, and is found to be involved in transducing the proliferating signals in normal diploid fibroblast and T cells. At least eight alternatively spliced transcript variants have been described, some of which are candidates for nonsense-mediated decay (NMD). The isoforms lacking the transmembrane domain may negatively regulate the apoptosis mediated by the full length isoform. [provided by RefSeq
Other Designations
APO-1 cell surface antigen|CD95 antigen|Fas AMA|Fas antigen|OTTHUMP00000020045|OTTHUMP00000020046|OTTHUMP00000020051|OTTHUMP00000059646|apoptosis antigen 1|tumor necrosis factor receptor superfamily member 6|tumor necrosis factor receptor superfamily, mem
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Increased death receptor pathway of apoptotic signaling in septic mouse aorta: effect of systemic delivery of FADD siRNA.
Matsuda N, Teramae H, Yamamoto S, Takano KI, Takano Y, Hattori Y.
American Journal of Physiology. Heart and Circulatory Physiology 2010 Jan; 298(1):H92.
Application:WB-Ti, Mouse, Mouse aortic vessels.
-
Silencing of fas-associated death domain protects mice from septic lung inflammation and apoptosis.
Matsuda N, Yamamoto S, Takano KI, Kageyama SI, Kurobe Y, Yoshiwara Y, Takano Y, Hattori Y.
American Journal of Respiratory and Critical Care Medicine 2009 May; 179(9):806.
Application:IF, WB-Ti, Mouse, Lung.
-
Increased death receptor pathway of apoptotic signaling in septic mouse aorta: effect of systemic delivery of FADD siRNA.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com