ACY1 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human ACY1 protein.
Immunogen
ACY1 (NP_000657.1, 1 a.a. ~ 408 a.a) full-length human protein.
Sequence
MTSKGPEEEHPSVTLFRQYLRIRTVQPKPDYGAAVAFFEETARQLGLGCQKVEVAPGYVVTVLTWPGTNPTLSSILLNSHTDVVPVFKEHWSHDPFEAFKDSEGYIYARGAQDMKCVSIQYLEAVRRLKVEGHRFPRTIHMTFVPDEEVGGHQGMELFVQRPEFHALRAGFALDEGIANPTDAFTVFYSERSPWWVRVTSTGRPGHASRFMEDTAAEKLHKVVNSILAFREKEWQRLQSNPHLKEGSVTSVNLTKLEGGVAYNVIPATMSASFDFRVAPDVDFKAFEEQLQSWCQAAGEGVTLEFAQKWMHPQVTPTDDSNPWWAAFSRVCKDMNLTLEPEIMPAATDNRYIRAVGVPALGFSPMNRTPVLLHDHDERLHEAVFLRGVDIYTRLLPALASVPALPSDS
Host
Rabbit
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (85); Rat (88)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
ACY1 MaxPab rabbit polyclonal antibody. Western Blot analysis of ACY1 expression in human liver.Western Blot (Tissue lysate)
ACY1 MaxPab rabbit polyclonal antibody. Western Blot analysis of ACY1 expression in mouse liver.Western Blot (Cell lysate)
ACY1 MaxPab rabbit polyclonal antibody. Western Blot analysis of ACY1 expression in MCF-7.Western Blot (Cell lysate)
ACY1 MaxPab rabbit polyclonal antibody. Western Blot analysis of ACY1 expression in NIH/3T3.Western Blot (Transfected lysate)
Western Blot analysis of ACY1 expression in transfected 293T cell line (H00000095-T01) by ACY1 MaxPab polyclonal antibody.
Lane 1: ACY1 transfected lysate(45.90 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — ACY1
Entrez GeneID
95GeneBank Accession#
NM_000666.1Protein Accession#
NP_000657.1Gene Name
ACY1
Gene Alias
ACY1D, ACYLASE
Gene Description
aminoacylase 1
Gene Ontology
HyperlinkGene Summary
Aminoacylase-1 is a cytosolic, homodimeric, zinc-binding enzyme that catalyzes the hydrolysis of acylated L-amino acids to L-amino acids and acyl group, and has been postulated to function in the catabolism and salvage of acylated amino acids. ACY1 has been assigned to chromosome 3p21.1, a region reduced to homozygosity in small-cell lung cancer (SCLC), and its expression has been reported to be reduced or undetectable in SCLC cell lines and tumors. The amino acid sequence of human aminoacylase-1 is highly homologous to the porcine counterpart, and ACY1 is the first member of a new family of zinc-binding enzymes. [provided by RefSeq
Other Designations
-
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com