ARHGAP1 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant ARHGAP1.
Immunogen
ARHGAP1 (AAH18118, 340 a.a. ~ 439 a.a) partial recombinant protein with GST tag.
Sequence
GFLNIDESQRVPATLQVLQTLPEENYQVLRFLTAFLVQISAHSDQNKMTNTNLAVVFGPNLLWAKDAAITLKAINPINTFTKFLLDHQGELFPSPDPSGL
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (91); Rat (83)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
ARHGAP1 polyclonal antibody (A01), Lot # ABNOVA060629QCS1 Western Blot analysis of ARHGAP1 expression in MES-SA/Dx5 ( Cat # L021V1 ).Western Blot (Cell lysate)
ARHGAP1 polyclonal antibody (A01), Lot # ABNOVA060629QCS1. Western Blot analysis of ARHGAP1 expression in Jurkat.Western Blot (Cell lysate)
ARHGAP1 polyclonal antibody (A01), Lot # ABNOVA060629QCS1. Western Blot analysis of ARHGAP1 expression in Raw 264.7.Western Blot (Cell lysate)
ARHGAP1 polyclonal antibody (A01), Lot # ABNOVA060629QCS1. Western Blot analysis of ARHGAP1 expression in PC-12.Western Blot (Cell lysate)
ARHGAP1 polyclonal antibody (A01), Lot # ABNOVA060629QCS1. Western Blot analysis of ARHGAP1 expression in NIH/3T3.Western Blot (Recombinant protein)
ELISA
-
Gene Info — ARHGAP1
-
Interactome
-
Disease
-
Publication Reference
-
Two-tiered Approach Identifies a Network of Cancer and Liver Disease-related Genes Regulated by miR-122.
Boutz DR, Collins PJ, Suresh U, Lu M, Ramirez CM, Fernandez-Hernando C, Huang Y, de Sousa Abreu R, Le SY, Shapiro BA, Liu AM, Luk JM, Force Aldred S, Trinklein ND, Marcotte EM, Penalva LO.
J Biol Chem 2011 Mar; 286:18066.
Application:WB-Tr, Human, Huh-7 cells.
-
Cdo promotes neuronal differentiation via activation of the p38 mitogen-activated protein kinase pathway.
Oh JE, Bae GU, Yang YJ, Yi MJ, Lee HJ, Kim BG, Krauss RS, Kang JS.
FASEB Journal 2009 Jul; 23(7):2088.
Application:WB, Mouse, C17.2 cells.
-
A Cdo-Bnip-2-Cdc42 signaling pathway regulates p38alpha/beta MAPK activity and myogenic differentiation.
Kang JS, Bae GU, Yi MJ, Yang YJ, Oh JE, Takaesu G, Zhou YT, Low BC, Krauss RS.
Journal of Cellular Biology 2008 Aug; 182(3):497.
Application:WB-Tr, Mouse, C2C12 cells.
-
Two-tiered Approach Identifies a Network of Cancer and Liver Disease-related Genes Regulated by miR-122.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com