SOCS3 monoclonal antibody (M02), clone 1E4

* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specifications
Product Description
Mouse monoclonal antibody raised against a full length recombinant SOCS3.
Immunogen
SOCS3 (AAH60858, 1 a.a. ~ 225 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLLSAEPAGTFLIRDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCVLKLVHHYMPPPGAPSFPSPPTEPSSEVPEQPSAQPLPGSPPRRAYYIYSGGEKIPLVLSRPLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (96); Rat (95)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to SOCS3 on formalin-fixed paraffin-embedded human colon. [antibody concentration 1.5 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SOCS3 is approximately 3ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to SOCS3 on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — SOCS3
Entrez GeneID
9021GeneBank Accession#
BC060858Protein Accession#
AAH60858Gene Name
SOCS3
Gene Alias
ATOD4, CIS3, Cish3, MGC71791, SOCS-3, SSI-3, SSI3
Gene Description
suppressor of cytokine signaling 3
Gene Ontology
HyperlinkOther Designations
STAT induced STAT inhibitor 3|cytokine-induced SH2 protein 3
-
Interactomes
-
Pathways
-
Diseases
- Anorexia Nervosa
- Arthritis
- Asthma
- Atherosclerosis
- Birth Weight
- Body Weight
- Bronchiolitis
- Bulimia
- Diabetes Mellitus
+ View More Disease
-
Publication Reference
-
SOCS3 Immunohistochemical Expression Seems to Support the 2005 and 2014 International Society of Urological Pathology (ISUP) Modified Gleason Grading System.
Pierconti F, Martini M, Cenci T, Petrone GL, Ricci R, Sacco E, Bassi PF, Larocca LM.
The Prostate 2017 May; 77(6):597.
Application:IHC-P, Human, Human prostatic acinar adenocarcinoma.
-
Role of SOCS3 evaluated by immunohistochemical analysis in a cohort of patients affected by prostate cancer: preliminary results.
Calarco A, Pinto F, Pierconti F, Sacco E, Marrucci E, Totaro A, Palermo G, Vittori M, Bassi P.
Urologia 2012 Dec; 79 Suppl 19:4.
Application:IHC, Human, Prostate cancer.
-
Epigenetic silencing of SOCS3 identifies a subset of prostate cancer with an aggressive behavior.
Pierconti F, Martini M, Pinto F, Cenci T, Capodimonti S, Calarco A, Bassi PF, Larocca LM.
Prostate 2011 Feb; 71(3):318.
Application:IHC-P, Human, Human prostate cancer.
-
SOCS3 Immunohistochemical Expression Seems to Support the 2005 and 2014 International Society of Urological Pathology (ISUP) Modified Gleason Grading System.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com