ANXA5 monoclonal antibody (M01), clone 1F4-1A5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
ANXA5 monoclonal antibody (M01), clone 1F4-1A5. Western Blot analysis of ANXA5 expression in HeLa.
Western Blot (Transfected lysate)
Western Blot analysis of ANXA5 expression in transfected 293T cell line by ANXA5 monoclonal antibody (M01), clone 1F4-1A5.
Lane 1: ANXA5 transfected lysate(35.9 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to ANXA5 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml]
Immunoprecipitation
Immunoprecipitation of ANXA5 transfected lysate using anti-ANXA5 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with ANXA5 MaxPab rabbit polyclonal antibody.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ANXA5 is approximately 0.03ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to ANXA5 on HeLa cell. [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (60.94 KDa) .
-
Specifications
Product Description
Mouse monoclonal antibody raised against a full length recombinant ANXA5.
Immunogen
ANXA5 (AAH01429, 1 a.a. ~ 320 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MAQVLRGTVTDFPGFDERADAETLRKAMKGLGTDEESILTLLTSRSNAQRQEISAAFKTLFGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRDPDAGIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVMVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGEDD
Host
Mouse
Reactivity
Human
Isotype
IgG1 kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (60.94 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
ANXA5 monoclonal antibody (M01), clone 1F4-1A5. Western Blot analysis of ANXA5 expression in HeLa.Western Blot (Transfected lysate)
Western Blot analysis of ANXA5 expression in transfected 293T cell line by ANXA5 monoclonal antibody (M01), clone 1F4-1A5.
Lane 1: ANXA5 transfected lysate(35.9 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to ANXA5 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml]Immunoprecipitation
Immunoprecipitation of ANXA5 transfected lysate using anti-ANXA5 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with ANXA5 MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ANXA5 is approximately 0.03ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to ANXA5 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — ANXA5
Entrez GeneID
308GeneBank Accession#
BC001429Protein Accession#
AAH01429Gene Name
ANXA5
Gene Alias
ANX5, ENX2, PP4
Gene Description
annexin A5
Omim ID
131230Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene belongs to the annexin family of calcium-dependent phospholipid binding proteins some of which have been implicated in membrane-related events along exocytotic and endocytotic pathways. Annexin 5 is a phospholipase A2 and protein kinase C inhibitory protein with calcium channel activity and a potential role in cellular signal transduction, inflammation, growth and differentiation. Annexin 5 has also been described as placental anticoagulant protein I, vascular anticoagulant-alpha, endonexin II, lipocortin V, placental protein 4 and anchorin CII. The gene spans 29 kb containing 13 exons, and encodes a single transcript of approximately 1.6 kb and a protein product with a molecular weight of about 35 kDa. [provided by RefSeq
Other Designations
anchorin CII|annexin 5|endonexin II|lipocortin V|placental anticoagulant protein I
-
Interactomes
-
Diseases
-
Publication Reference
-
Transcellular distribution heterogeneity of Annexin A5 represents a protective response to lupus-related thrombophilia: a pilot Proteomics-based study.
Zhou D, Luo N, Wu Q, You Y, Zhai Z, Mou Z, Wu Y, Hao F.
Biochemical and Biophysical Research Communications 2012 Apr; 420(2):357.
Application：WB, Human, PBMCs.
-
Proteomics and bioinformatics analysis of lovastatin-induced differentiation in ARO cells.
Shui HA, Hsia CW, Chen HM, Chang TC, Wang CY.
Journal of Proteomics 2012 Feb; 75(4):1170.
Application：WB-Ce, Human, ARO cells.
-
The Differential Expression of Aqueous Soluble Proteins in Breast Normal and Cancerous Tissues in Relation to Stage and Grade of Patients.
Liang S, Singh M, Gam LH.
Journal of Biomedicine & Biotechnology 2010 Dec; 2010:516469.
Application：WB-Ti, Human, Breast.
-
Transcellular distribution heterogeneity of Annexin A5 represents a protective response to lupus-related thrombophilia: a pilot Proteomics-based study.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com