Product Browser

Last updated: 2023/3/19

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Bulk order
Custom Services
2019 Next Day Shipping

P2RY12 polyclonal antibody 

  • Catalog # : PAB31824
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against recombinant human P2RY12.
  • Sequence:
  • KSFRNSLISMLKCPNSATSLSQDNRKKEQDGGDPNEETPM
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Specificity:
  • This antibody reacts to P2RY12.
  • Form:
  • Liquid
  • Purification:
  • Affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunohistochemistry (1:1000 - 1:2500)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH7.2 (40% glycerol, 0.02% sodium azide).
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Immunohistochemistry
  • Immunohistochemistry
  • Immunohistochemical staining of human testis shows no positivity in cells in semiferous ducts as expected.
  • Immunohistochemistry
  • Immunohistochemistry
  • Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in microglia.
  • Immunohistochemistry
  • Immunohistochemistry
  • Immunohistochemical staining of human cerebellum shows strong cytoplamic positivity in microglia.
  • Immunohistochemistry
  • Immunohistochemistry
  • Immunohistochemical staining of human liver shows no positivity as expected.
  • Application Image
  • Gene Information
  • Gene Name:
  • P2RY12
  • Gene Alias:
  • ADPG-R,HORK3,P2T(AC),P2Y(AC),P2Y(ADP),P2Y(cyc),P2Y12,SP1999
  • Gene Description:
  • purinergic receptor P2Y, G-protein coupled, 12
  • Gene Summary:
  • The product of this gene belongs to the family of G-protein coupled receptors. This family has several receptor subtypes with different pharmacological selectivity, which overlaps in some cases, for various adenosine and uridine nucleotides. This receptor is involved in platelets aggregation, and is a potential target for the treatment of thromboembolisms and other clotting disorders. Two transcript variants encoding the same isoform have been identified for this gene. [provided by RefSeq
  • Other Designations:
  • ADP-glucose receptor,G-protein coupled receptor SP1999,Gi-coupled ADP receptor HORK3,P2Y purinoceptor 12,platelet ADP receptor,purinergic receptor P2RY12,purinergic receptor P2Y12,putative G-protein coupled receptor
  • RSS
  • YouTube
  • Linkedin
  • Facebook