Product Browser

Last updated: 2023/6/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TOMM20 polyclonal antibody 

  • Catalog # : PAB31823
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against recombinant human TOMM20.
  • Sequence:
  • KRRSDPNFKNRLRERRKKQKLAKERAGLSKLPDLKDAEAVQKFFLEEIQLGEELLAQGEYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKL PTISQRIVSAQSLAEDDV
  • Host:
  • Rabbit
  • Reactivity:
  • Human, Mouse
  • Specificity:
  • This antibody reacts to to TOMM20.
  • Form:
  • Liquid
  • Purification:
  • Affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunofluorescence (0.25-2 ug/mL)
    Immunohistochemistry (1:500 - 1:1000)
    Western Blot (0.04-0.4 ug/mL)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH7.2 (40% glycerol, 0.02% sodium azide).
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • Western blot analysis of mouse cell lines NIH-3T3.
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • Western blot analysis of human cell lines HEK293 and MCF-7 using TOMM20 polyclonal antibody (Cat # PAB31823). Loading control: Anti-HSP90B1.
  • Immunohistochemistry
  • Immunohistochemistry
  • Immunohistochemical staining of human prostate shows strong positivity in mitochondrial in glandular cells.
  • Immunohistochemistry
  • Immunohistochemistry
  • Immunohistochemical staining of human endometrium shows strong positivity in mitochondrial in glandular cells.
  • Immunohistochemistry
  • Immunohistochemistry
  • Immunohistochemical staining of human cerebral cortex shows strong positivity in mitochondrial in neurons.
  • Immunohistochemistry
  • Immunohistochemistry
  • Immunohistochemical staining of human duodenum shows strong positivity in mitochondrial in glandular cells.
  • Immunofluorescence
  • Immunofluorescence
  • Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondrial.
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 9804
  • Gene Name:
  • TOMM20
  • Gene Alias:
  • KIAA0016,MAS20,MGC117367,MOM19,TOM20
  • Gene Description:
  • translocase of outer mitochondrial membrane 20 homolog (yeast)
  • Other Designations:
  • OTTHUMP00000037593,translocase of outer mitochondrial membrane 20 homolog,translocase of outer mitochondrial membrane 20 homolog type II
  • RSS
  • YouTube
  • Linkedin
  • Facebook