CSTA polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
Western blot analysis of Lane 1: Human cell line RT-4 Lane 2: Human cell line U-251MG sp Lane 3: Human cell line A-431 Lane 4: Human liver tissue Lane 5: Human tonsil tissue with CSTA polyclonal antibody (Cat # PAB29355) at 1:250-1:500 dilution.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human skin with CSTA polyclonal antibody (Cat # PAB29355) shows strong cytoplasmic and nuclear positivity in squamous epithelial cells at 1:50-1:200 dilution.
Immunofluorescence
Immunofluorescent staining of human cell line U-2 OS with CSTA polyclonal antibody (Cat # PAB29355) at 1-4 ug/mL concentration shows positivity in nucleus and cytoplasm.
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant human CSTA.
Immunogen
Recombinant protein corresponding to human CSTA.
Sequence
IPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRAGDNKYMHLKVFKSLPGQNEDLV
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 ug/mL)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western blot analysis of Lane 1: Human cell line RT-4 Lane 2: Human cell line U-251MG sp Lane 3: Human cell line A-431 Lane 4: Human liver tissue Lane 5: Human tonsil tissue with CSTA polyclonal antibody (Cat # PAB29355) at 1:250-1:500 dilution.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human skin with CSTA polyclonal antibody (Cat # PAB29355) shows strong cytoplasmic and nuclear positivity in squamous epithelial cells at 1:50-1:200 dilution.Immunofluorescence
Immunofluorescent staining of human cell line U-2 OS with CSTA polyclonal antibody (Cat # PAB29355) at 1-4 ug/mL concentration shows positivity in nucleus and cytoplasm. -
Gene Info — CSTA
Entrez GeneID
1475Gene Name
CSTA
Gene Alias
STF1, STFA
Gene Description
cystatin A (stefin A)
Omim ID
184600Gene Ontology
HyperlinkGene Summary
The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins, and kininogens. This gene encodes a stefin that functions as a cysteine protease inhibitor, forming tight complexes with papain and the cathepsins B, H, and L. The protein is one of the precursor proteins of cornified cell envelope in keratinocytes and plays a role in epidermal development and maintenance. Stefins have been proposed as prognostic and diagnostic tools for cancer. [provided by RefSeq
Other Designations
cystatin A|cystatin AS|stefin A
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com