Product Browser

Last updated: 2023/3/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Bulk order
Custom Services
2019 Next Day Shipping

Il25 (Mouse) Recombinant protein 

  • Catalog # : P8771
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse Il25 (Q8VHH8) recombinant protein expressed in Escherichia Coli.
  • Sequence:
  • VSLRIQEGCSHLPSCCPSKEQEPPEEWLKWSSASVSPPEPLSHTHHAESCRASKDGPLNSRAISPWSYELDRDLNRVPQDLYHARCLCPHCVSLQTGSHMDPLGNSVPL YHNQTVFYRRPCHGEEGTHRRYCLERRLYRVSLACV CVRPRVMA.
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 35.5
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Purity:
  • > 95% by SDS-PAGE
    > 95% by RP-HPLC
  • Activity:
  • The activity is determined by the dose-dependant production of IL-8 by human PBMCs, the ED50 is 322 - 488 ng/mL.
  • Storage Buffer:
  • Lyophilized from with no additives
  • Storage Instruction:
  • Lyophilized although stable at room temperature for 3 weeks. should be stored desiccated below -20°C. Upon reconstitution should be stored at 4°C between 2-7 days and for future use below -20°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Gene Name:
  • Il25
  • Gene Alias:
  • IL-17E,Il17e
  • Gene Description:
  • interleukin 25
  • Other Designations:
  • interleukin 17E
  • RSS
  • YouTube
  • Linkedin
  • Facebook