Product Browser

Last updated: 2023/3/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Bulk order
Custom Services
2019 Next Day Shipping

Fgf17 (Mouse) Recombinant Protein 

  • Catalog # : P8619
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse Fgf17 recombinant protein expressed in?Escherichia coli.
  • Sequence:
  • TQGENHPSPNFNQYVRDQGAMTDQLSRRQIREYQLYSRTSGKHVQVTGRRISATAEDGNKFAKLIVETDTFGSRVRIKGAESEKYICMNKRGKLIGKPSGKSKDCVFTEIVLENNYTAFQNARHEGWFMAFTRQGRPRQASRSRQNQREAHFIKRLYQGQLPFPNHAERQKQFEFVGSAPTRRTKRTRRPQSQT
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 22.5
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Purification:
  • chromatography
  • Activity:
  • ED50 < 10 ng/mL, measure by a cell proliferation assay using murine balb/c 3T3 cells, corresponding to a Specific Activity of 1 x 105Units/mg.
  • Surface Modification:
  • Greater than 98.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.
  • Storage Buffer:
  • Lyophilized from 20 mM Tris-HCl buffer(pH 8.0) cantaining?0.02% Tween-20 and 700 mM NaCl. Reconstitute the lyophilized powder in PBS to 100 ug/mL.
  • Storage Instruction:
  • Lyophilized protein at room temperature for 3 weeks, should be stored at -20°C. Protein aliquots at 4°C for 2-7 days and should be stored at -20°C to -80°C.
    Avoid repeated freeze/thaw cycles.
  • Applications
  • Functional Study
  • Application Image
  • Functional Study
  • Gene Information
  • Gene Name:
  • Fgf17
  • Gene Alias:
  • -
  • Gene Description:
  • fibroblast growth factor 17
  • Other Designations:
  • -
  • RSS
  • YouTube
  • Linkedin
  • Facebook