Product Browser

Last updated: 2023/3/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Bulk order
Custom Services
2019 Next Day Shipping

FGF17 (Human) Recombinant Protein 

  • Catalog # : P8617
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human FGF17 recombinant protein expressed in Escherichia coli.
  • Sequence:
  • MTQGENHPSPNFNQYVRDQGAMTDQLSRRQIREYQLYSRTSGKHVQVTGRRISATAEDGNKFAKLIVETDTFGSRVRIKGAESEKYICMNKRGKLIGKPSGKSKDCVFTEIVLENNYTAFQNARHEGWFMAFTRQGRPRQASRSRQNQREAHFIKRLYQGQLPFPNHAEKQKQFEFVGSAPTRRTKRTRRPQPLT
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 22.6
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Activity:
  • ED50 < 10 ng/mL, measure by a cell proliferation assay using murine balb/c 3T3 cells, corresponding to a Specific Activity of > 1 x 105Units/mg.
  • Surface Modification:
  • Greater than 95.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.
  • Storage Buffer:
  • Lyophilized from a solution containing 1X PBS, pH 7.4. Reconstitute the lyophilized powder in ddH2O to 100 ug/mL.
  • Storage Instruction:
  • Lyophilized protein at room temperature for 3 weeks, should be stored at -20°C. Protein aliquots at 4°C for 2-7 days and should be stored at -20°C to -80°C.
    Avoid repeated freeze/thaw cycles.
  • Applications
  • Functional Study
  • Application Image
  • Functional Study
  • Gene Information
  • Entrez GeneID:
  • 8822
  • Gene Name:
  • FGF17
  • Gene Alias:
  • FGF-13
  • Gene Description:
  • fibroblast growth factor 17
  • Gene Summary:
  • The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes including embryonic development cell growth, morphogenesis, tissue repair, tumor growth and invasion. This gene was shown to be prominently expressed in the cerebellum and cortex. The mouse homolog of this gene was localized to specific sites in the midline structures of the forebrain, the midbrain-hindbrain junction, developing skeleton and developing arteries, which suggests a role in central nervous system, bone and vascular development. This gene was referred to as FGF-13 in reference 2, however, its amino acid sequence and chromosomal localization are identical to FGF17. [provided by RefSeq
  • Other Designations:
  • -
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook