Last updated: 2023/3/26

Click this icon to add products to compare list. Select up to 10 products.

FGF16 (Human) Recombinant Protein

Sequence:
AEVGGVFASLDWDLHGFSSSLGNVPLADSPGFLNERLGQIEGKLQRGSPTDFAHLKGILRRRQLYCRTGFHLEIFPNGTVHGTRHDHSRFGILEFISLAVGLISIRGVDSGLYLGMNERGELYGSKKLTRECVFREQFEENWYNTYASTLYKHSDSERQYYVALNKDGSPREGYRTKRHQKFTHFLPRPVDPSKLPSMSRDLFHYR

Activity:
ED₅₀ < 0.5 ng/mL, measure by t thymidine uptake assay using FGF-receptors transfected BaF3 cells expressing FGF receptors, corresponding to a Specific Activity of > 2 x 10⁶Units/mg.

Surface Modification:
Greater than 98.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.

Storage Buffer:
Solution in 20mM Tris-HCl buffer (pH 9.0) cantaining 10% Glycerol, 1M NaCl, 0.2% Tween-20.

Storage Instruction:
Stored at 4°C for 2-4 weeks, should be stored at -20°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid repeated freeze/thaw cycles.

Gene Summary:
The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. The rat homolog is predominantly expressed in embryonic brown adipose tissue and has significant mitogenic activity, which suggests a role in proliferation of embryonic brown adipose tissue. [provided by RefSeq