Product Browser

Last updated: 2023/3/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Bulk order
Custom Services
2019 Next Day Shipping

Fgf15 (Mouse) Recombinant Protein 

  • Catalog # : P8614
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse Fgf15 recombinant protein with His tag at N-terminus expressed in?Escherichia coli.
  • Sequence:
  • MKHHHHHHASRPLAQQSQSVSDEDPLFLYGWGKITRLQYLYSAGPYVSNCFLRIRSDGSVDCEEDQNERNLLEFRAVALKTIAIKDVSSVRYLCMSADGKIYGLIRYSEEDCTFREEMDCLGYNQYRSMKHHLHIIFIQAKPREQLQDQKPSNFIPVFHRSFFETGDQLRSKMFSLPLESDSMDPFRMVEDVDHLVKSPSFQK
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 23.78
  • Form:
  • Liquid
  • Preparation Method:
  • Escherichia coli expression system
  • Purification:
  • chromatography
  • Surface Modification:
  • Greater than 90.0% as determined by SDS-PAGE.
  • Storage Buffer:
  • Solution in 20mM Tris buffer (pH 8.5), 50mM NaCl
  • Storage Instruction:
  • Stored at 4°C for 2-4 weeks, should be stored at -20°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
    Avoid repeated freeze/thaw cycles.
  • Applications
  • SDS-PAGE
  • Application Image
  • SDS-PAGE
  • Gene Information
  • Gene Name:
  • Fgf15
  • Gene Alias:
  • FGF19
  • Gene Description:
  • fibroblast growth factor 15
  • Other Designations:
  • -
  • RSS
  • YouTube
  • Linkedin
  • Facebook