Product Browser

Last updated: 2023/3/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Bulk order
Custom Services
2019 Next Day Shipping

FGF14 (Human) Recombinant Protein 

  • Catalog # : P8613
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human FGF14 full-length recombinant protein with His tag at N-terminus expressed in Escherichia coli.
  • Sequence:
  • MGSSHHHHHHSSGLVPRGSHMGSHMAAAIASGLIRQKRQAREQHWDRPSASRRRSSPSKNRGLCNGNLVDIFSKVRIFGLKKRRLRRQDPQLKGIVTRLYCRQGYYLQMHPDGALDGTKDDSTNSTLFNLIPVGLRVVAIQGVKTGLYIAMNGEGYLYPSELFTPECKFKESVFENYYVIYSSMLYRQQESGRAWFLGLNKEGQAMKGNRVKKTKPAAHFLPKPLEVAMYREPSLHDVGETVPKPGVTPSKSTSASAIMNGGKPVNKSKTT
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 30
  • Form:
  • Liquid
  • Preparation Method:
  • Baculovirus expression system
  • Purification:
  • chromatography
  • Surface Modification:
  • Greater than 90% as determined by SDS-PAGE.
  • Storage Buffer:
  • Solution (0.25mg/ml) in 20mM Tris-HCl buffer (pH 8.0) containing 50% glycerol ,0.2M NaCl, 5mM DTT.
  • Storage Instruction:
  • Stored at 4°C for 2-4 weeks, should be stored at -20°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
    Avoid repeated freeze/thaw cycles.
  • Applications
  • SDS-PAGE
  • Application Image
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 2259
  • Gene Name:
  • FGF14
  • Gene Alias:
  • FHF4,MGC119129,SCA27
  • Gene Description:
  • fibroblast growth factor 14
  • Gene Summary:
  • The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. A mutation in this gene is associated with autosomal dominant cerebral ataxia. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000018661,OTTHUMP00000018662,OTTHUMP00000040726,bA397O8.2,fibroblast growth factor homologous factor 4
  • RSS
  • YouTube
  • Linkedin
  • Facebook