Product Browser

Last updated: 2023/3/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

Fgf2 (Rat) Recombinant Protein 

  • Catalog # : P8599
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rat Fgf2 recombinant protein expressed in?Escherichia coli.
  • Sequence:
  • MPALPEDGGGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 16.4
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Purification:
  • chromatography
  • Purity:
  • > 95% as determined by SDS-PAGE.
  • Activity:
  • ED50 is 0.903 ng/mL, measure by the dose-dependant proliferation of NR6R-3T3 cells, corresponding to a Specific Activity of 1.1 x 107Units/mg.
  • Storage Buffer:
  • Protein(1 mg/mL) was lyophilized from a solution containing 5mM Na2PO4, pH7.5, 50mM NaCl. Reconstitute the lyophilized powder in ddH2O to 101 ug/mL.
  • Storage Instruction:
  • Lyophilized protein at room temperature for 3 weeks, should be stored at -20°C. Protein aliquots at 4°C for 2-7 days and should be stored at -20°C to -80°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
    Avoid repeated freeze/thaw cycles.
  • Applications
  • Functional Study
  • Application Image
  • Functional Study
  • Gene Information
  • Gene Name:
  • Fgf2
  • Gene Alias:
  • Fgf-2,bFGF
  • Gene Description:
  • fibroblast growth factor 2
  • Other Designations:
  • basic fibroblast growth factor
  • RSS
  • YouTube
  • Linkedin
  • Facebook