Product Browser

Last updated: 2023/3/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

Fgf1 (Rat) Recombinant Protein 

  • Catalog # : P8590
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rat Fgf1 recombinant protein expressed in Escherichia coli.
  • Sequence:
  • MFNLPLGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESAGEVYIKGTETGQYLAMDTEGLLYGSQTPNEECLFLERLEENHYNTYTSKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 15.9
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Purification:
  • Chromatography
  • Purity:
  • > 98% as determined by SDS-PAGE.
  • Activity:
  • ED50 <0.2 ng/mL, measured by dose-dependent proliferation of mouse BALB/c 3T3 cells, corresponding to a specific activity of 5 x 106?IU/mg.
  • Storage Buffer:
  • Lyophilized from 5 mM Na2PO4, 50 mM NaCl solution, pH7.5,. Reconstitute the lyophilized powder in ddH2O to 100 ug/mL.
  • Storage Instruction:
  • Stored at room temperature for 3 weeks, should be stored at -20°C. Protein aliquots at 4°C for 2-7 days and should be stored at -20°C to -80°C for long term storage.
    Avoid repeated freeze/thaw cycles.
  • Applications
  • Functional Study
  • Application Image
  • Functional Study
  • Gene Information
  • Gene Name:
  • Fgf1
  • Gene Alias:
  • HBGF-1,HBGF1
  • Gene Description:
  • fibroblast growth factor 1
  • Other Designations:
  • Fibroblast growth factor 1 (heparin binding)
  • Interactome
  • Interactome
  • RSS
  • YouTube
  • Linkedin
  • Facebook