Product Browser

Last updated: 2023/3/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Bulk order
Custom Services
2019 Next Day Shipping

FGF1 (Human) Recombinant Protein 

  • Catalog # : P8587
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human FGF1 recombinant protein expressed in Escherichia coli.
  • Sequence:
  • AEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 17.3
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Purification:
  • Chromatography
  • Purity:
  • > 97% as determined by (a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.
  • Activity:
  • ED50 <0.5 ng/mL, measured by cell proliferation assay using murine balb/c 3T3 cells, corresponding to a specific activity >2 x 10 6?IU/mg.
  • Storage Buffer:
  • Lyophilized from a solution containing 1X PBS, pH 7.4 (0.5 mM DTT, 2 mM EDTA, 5 % Trehalose). Reconstitute the lyophilized powder in ddH2O to 100 ug/mL.
  • Storage Instruction:
  • Stored at room temperature for 3 weeks, should be stored at -20°C. Protein aliquots at 4°C for 2-7 days and should be stored at -20°C to -80°C for long term storage.
    Avoid repeated freeze/thaw cycles.
  • Applications
  • Functional Study
  • Application Image
  • Functional Study
  • Gene Information
  • Entrez GeneID:
  • 2246
  • Gene Name:
  • FGF1
  • Gene Alias:
  • AFGF,ECGF,ECGF-beta,ECGFA,ECGFB,FGF-alpha,FGFA,GLIO703,HBGF1
  • Gene Description:
  • fibroblast growth factor 1 (acidic)
  • Gene Summary:
  • The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein functions as a modifier of endothelial cell migration and proliferation, as well as an angiogenic factor. It acts as a mitogen for a variety of mesoderm- and neuroectoderm-derived cells in vitro, thus is thought to be involved in organogenesis. Multiple alternatively spliced variants encoding different isoforms have been described. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000066028,OTTHUMP00000066030,OTTHUMP00000066031,OTTHUMP00000174675,endothelial cell growth factor, alpha,endothelial cell growth factor, beta,heparin-binding growth factor 1
  • Interactome
  • Interactome
  • RSS
  • YouTube
  • Linkedin
  • Facebook