Product Browser

Last updated: 2023/3/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Bulk order
Custom Services
2019 Next Day Shipping

EPOR (Human) Recombinant Protein 

  • Catalog # : P8579
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human EPOR partial recombinant protein with His tag in C-terminus expressed in Baculovirus cells.
  • Sequence:
  • APPPNLPDPKFESKAALLAARGPEELLCFTERLEDLVCFWEEAASAGVGPGNYSFSYQLEDEPWKLCRLHQAPTARGAVRFWCSLPTADTSSFVPLELRVTAASGAPRYHRVIHINEVVLLDAPVGLVARLADESGHVVLRWLPPPETPMTSHIRYEVDVSAGNGAGSVQRVEILEGRTECVLSNLRGRTRYTFAVRARMAEPSFGGFWSAWSEPVSLLTPSDLDPHHHHHH
  • Host:
  • Viruses
  • Theoretical MW (kDa):
  • 25.6
  • Form:
  • Liquid
  • Preparation Method:
  • Baculovirus expression system
  • Purification:
  • Chromatography
  • Purity:
  • > 95% as determined by SDS-PAGE.
  • Activity:
  • ED50 ≤ 70 ng/mL, measured by its ability to inhibit EPO dependent proliferation assay using TF-1 human erythroleukemic cells.
  • Storage Buffer:
  • In? PBS, pH 7.4 (10% glycerol).
  • Storage Instruction:
  • Stored at 4°C for 2-4 weeks, should be stored at -20°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
    Avoid repeated freeze/thaw cycles.
  • Applications
  • Functional Study
  • Application Image
  • Functional Study
  • Gene Information
  • Entrez GeneID:
  • 2057
  • Gene Name:
  • EPOR
  • Gene Alias:
  • MGC138358
  • Gene Description:
  • erythropoietin receptor
  • Gene Summary:
  • The erythropoietin receptor is a member of the cytokine receptor family. Upon erythropoietin binding, the erythropoietin receptor activates Jak2 tyrosine kinase which activates different intracellular pathways including: Ras/MAP kinase, phosphatidylinositol 3-kinase and STAT transcription factors. The stimulated erythropoietin receptor appears to have a role in erythroid cell survival. Defects in the erythropoietin receptor may produce erythroleukemia and familial erythrocytosis. [provided by RefSeq
  • Other Designations:
  • -
  • RSS
  • YouTube
  • Linkedin
  • Facebook