Product Browser

Last updated: 2023/3/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Bulk order
Custom Services
2019 Next Day Shipping

EPO (Human) Recombinant Protein 

  • Catalog # : P8574
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human EPO partial recombinant protein with His tag in C-terminus expressed in?Baculovirus cells.
  • Sequence:
  • APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALRAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDRLEHHHHHH
  • Host:
  • Viruses
  • Theoretical MW (kDa):
  • 19.5
  • Form:
  • Liquid
  • Preparation Method:
  • Baculovirus expression system
  • Purification:
  • Chromatography
  • Purity:
  • > 95% as determined by SDS-PAGE.
  • Activity:
  • ED50 ≤ 0.5 ng/mL, measured in a cell proliferation assay using TF-1 human erythroleukemic cells.
  • Storage Buffer:
  • In? PBS, pH 7.4 (10% glycerol).
  • Storage Instruction:
  • Stored at 4°C for 2-4 weeks, should be stored at -20°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
    Avoid repeated freeze/thaw cycles.
  • Applications
  • Functional Study
  • Application Image
  • Functional Study
  • Gene Information
  • Entrez GeneID:
  • 2056
  • Gene Name:
  • EPO
  • Gene Alias:
  • EP,MGC138142
  • Gene Description:
  • erythropoietin
  • Gene Summary:
  • This gene is a member of the EPO/TPO family and encodes a secreted, glycosylated cytokine composed of four alpha helical bundles. The protein is found in the plasma and regulates red cell production by promoting erythroid differentiation and initiating hemoglobin synthesis. This protein also has neuroprotective activity against a variety of potential brain injuries and antiapoptotic functions in several tissue types. [provided by RefSeq
  • Other Designations:
  • epoetin
  • RSS
  • YouTube
  • Linkedin
  • Facebook