Product Browser

Last updated: 2023/3/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Bulk order
Custom Services
2019 Next Day Shipping

APOA1 (Human) Recombinant Protein 

  • Catalog # : P8418
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human APOA1 (P02647, 25-267 a.a.) partial-length recombinant protein with His-tag at N-terminal expressed in Escherichia coli .
  • Amount:
  • > 95% by SDS-PAGE
  • Sequence:
  • MGSSHHHHHHSSGLVPRGSHMDEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ.
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 30.3
  • Form:
  • Liquid
  • Preparation Method:
  • Escherichia coli expression system
  • Storage Buffer:
  • 20mM Tris-HCl buffer (pH8.0) and 10% glycerol.
  • Storage Instruction:
  • Store, frozen at -20°C for longer periods of time.
    For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
    Avoid multiple freeze-thaw cycles.
  • Applications
  • SDS-PAGE
  • Application Image
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 335
  • Gene Name:
  • APOA1
  • Gene Alias:
  • MGC117399
  • Gene Description:
  • apolipoprotein A-I
  • Gene Summary:
  • This gene encodes apolipoprotein A-I, which is the major protein component of high density lipoprotein (HDL) in plasma. The protein promotes cholesterol efflux from tissues to the liver for excretion, and it is a cofactor for lecithin cholesterolacyltransferase (LCAT) which is responsible for the formation of most plasma cholesteryl esters. This gene is closely linked with two other apolipoprotein genes on chromosome 11. Defects in this gene are associated with HDL deficiencies, including Tangier disease, and with systemic non-neuropathic amyloidosis. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000069346,OTTHUMP00000069347,OTTHUMP00000069348,apolipoprotein A1
  • Interactome
  • Interactome
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook