Product Browser

Last updated: 2023/3/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Bulk order
Custom Services
2019 Next Day Shipping

ANGPTL7 (Human) Recombinant Protein 

  • Catalog # : P8415
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human ANGPTL7 (O43827, 27 a.a. - 346 a.a.) partial-length recombinant protein expressed in HEK293 cells.
  • Amount:
  • > 90% by SDS-PAGE
  • Sequence:
  • QKLSKHKTPAQPQLKAANCCEEVKELKAQVANLSSLLSELNKKQERDWVSVVMQVMELESNSKRMESRLTDAESKYSEMNNQIDIMQLQAAQTVTQTSADAIYDCSSLYQKNYRISGVYKLPPDDFLGSPELEVFCDMETSGGGWTIIQRRKSGLVSFYRDWKQYKQGFGSIRGDFWLGNEHIHRLSRQPTRLRVEMEDWEGNLRYAEYSHFVLGNELNSYRLFLGNYTGNVGNDALQYHNNTAFSTKDKDNDNCLDKCAQLRKGGYWYNCCTDSNLNGVYYRLGEHNKHLDGITWYGWHGSTYSLKRVEMKIRPEDFKPLEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
  • Host:
  • Human
  • Theoretical MW (kDa):
  • 63.2
  • Form:
  • Liquid
  • Preparation Method:
  • HEK 293T cell expression system
  • Storage Buffer:
  • 10% glycerol and Phosphate-Buffered Saline (pH 7.4).
  • Storage Instruction:
  • Store, frozen at -20°C for longer periods of time.
    For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
    Avoid multiple freeze-thaw cycles.
  • Applications
  • SDS-PAGE
  • Application Image
  • SDS-PAGE
  • Gene Information
  • Gene Name:
  • ANGPTL7
  • Gene Alias:
  • AngX,CDT6,RP4-647M16.2,dJ647M16.1
  • Gene Description:
  • angiopoietin-like 7
  • Other Designations:
  • OTTHUMP00000001986,angiopoietin-like factor (CDT6)
  • RSS
  • YouTube
  • Linkedin
  • Facebook