Product Browser

Last updated: 2023/3/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Bulk order
Custom Services
2019 Next Day Shipping

ANGPTL3 (Human) Recombinant Protein 

  • Catalog # : P8411
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human ANGPTL3 (Q9Y5C1, 17 a.a. - 460 a.a.) partial-length recombinant protein with His-tag at C-terminal expressed in Baculovirus.
  • Amount:
  • > 90% by SDS-PAGE
  • Sequence:
  • ADPSRIDQDNSSFDSLSPEPKSRFAMLDDVKILANGLLQLGHGLKDFVHKTKGQINDIFQKLNIFDQSFYDLSLQTSEIKEEEKELRRTTYKLQVKNEEVKNMSLELNSKLESLLEEKILLQQKVKYLEEQLTNLIQNQPETPEHPEVTSLKTFVEKQDNSIKDLLQTVEDQYKQLNQQHSQIKEIENQLRRTSIQEPTEISLSSKPRAPRTTPFLQLNEIRNVKHDGIPAECTTIYNRGEHTSGMYAIRPSNSQVFHVYCDVISGSPWTLIQHRIDGSQNFNETWENYKYGFGRLDGEFWLGLEKIYSIVKQSNYVLRIELEDWKDNKHYIEYSFYLGNHETNYTLHLVAITGNVPNAIPENKDLVFSTWDHKAKGHFNCPEGYSGGWWWHDECGENNLNGKYNKPRAKSKPERRRGLSWKSQNGRLYSIKSTKMLIHPTDSESFEHHHHHH.
  • Host:
  • Viruses
  • Theoretical MW (kDa):
  • 52.9
  • Form:
  • Liquid
  • Preparation Method:
  • Baculovirus expression system
  • Storage Buffer:
  • Buffered Saline (pH 7.4),30% glycerol And 1mM DTT.
  • Storage Instruction:
  • Store, frozen at -20°C for longer periods of time.
    For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
    Avoid multiple freeze-thaw cycles.
  • Applications
  • SDS-PAGE
  • Application Image
  • SDS-PAGE
  • Gene Information
  • Gene Name:
  • ANGPTL3
  • Gene Alias:
  • ANGPT5
  • Gene Description:
  • angiopoietin-like 3
  • Gene Summary:
  • The protein encoded by this gene is a member of the angiopoietin-like family of secreted factors. It is predominantly expressed in the liver, and has the characteristic structure of angiopoietins, consisting of a signal peptide, N-terminal coiled-coil domain and the C-terminal fibrinogen (FBN)-like domain. The FBN-like domain in angiopoietin-like 3 protein was shown to bind alpha-5/beta-3 integrins, and this binding induced endothelial cell adhesion and migration. This protein may also play a role in the regulation of angiogenesis. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000010719,angiopoietin 5
  • RSS
  • YouTube
  • Linkedin
  • Facebook