Product Browser

Last updated: 2023/3/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Bulk order
Custom Services
2019 Next Day Shipping

TNFRSF18 (Human) Recombinant Protein 

  • Catalog # : P8403
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human TNFRSF18 (Q9UNG2, 50 a.a. - 177 a.a.) partial-length recombinant protein with His-tag at C-terminal expressed in Escherichia coli.
  • Amount:
  • > 85% by SDS-PAGE
  • Sequence:
  • MQLETAKEPCMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSEHQVLKNNTYWGIILIANPQEISLEHHHHHH.
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 15.6
  • Form:
  • Liquid
  • Preparation Method:
  • Escherichia coli expression system
  • Storage Buffer:
  • 20mM Tris-HCl buffer (pH8.0) & 10% glycerol.
  • Storage Instruction:
  • Store, frozen at -20°C for longer periods of time.
    For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
    Avoid multiple freeze-thaw cycles.
  • Applications
  • SDS-PAGE
  • Application Image
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 8995
  • Gene Name:
  • TNFSF18
  • Gene Alias:
  • AITRL,GITRL,MGC138237,TL6,hGITRL
  • Gene Description:
  • tumor necrosis factor (ligand) superfamily, member 18
  • Gene Summary:
  • The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for receptor TNFRSF18/AITR/GITR. It has been shown to modulate T lymphocyte survival in peripheral tissues. This cytokine is also found to be expressed in endothelial cells, and is thought to be important for interaction between T lymphocytes and endothelial cells. [provided by RefSeq
  • Other Designations:
  • AITR ligand,GITR ligand,glucocorticoid-induced TNFR-related protein ligand
  • RSS
  • YouTube
  • Linkedin
  • Facebook