Product Browser

Last updated: 2023/3/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Bulk order
Custom Services
2019 Next Day Shipping

AIF1 (Human) Recombinant Protein 

  • Catalog # : P8399
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human AIF1 (P55008) recombinant protein with His-tag at N-terminal expressed in Escherichia coli .
  • Amount:
  • > 90% by SDS-PAGE
  • Sequence:
  • MKHHHHHHASQTRDLQGGKAF?GLLKAQQEERLDE-INKQFLDDPKYSSDED?LPSKLEGFKEKYMEF?DLNGNGDIDIMSLKRMLEK-LGVPKTHLELKKLI?GEVSSGSGETFSYP?DFLRMMLGKRSAIL-KMILMYEEKAREKEK?PTGPPAKKAISELP.
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 17.7
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Storage Buffer:
  • Lyophilized from 20mM Tris buffer and 50mM NaCl pH-7.5.
  • Storage Instruction:
  • For long term, store at -20°C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
  • Applications
  • SDS-PAGE
  • Application Image
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 199
  • Gene Name:
  • AIF1
  • Gene Alias:
  • AIF-1,IBA1,IRT-1
  • Gene Description:
  • allograft inflammatory factor 1
  • Gene Summary:
  • This gene is induced by cytokines and interferon. Its protein product is thought to be involved in negative regulation of growth of vascular smooth muscle cells, which contributes to the anti-inflammatory response to vessel wall trauma. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000029354,OTTHUMP00000029356,interferon gamma responsive transcript,ionized calcium-binding adapter molecule
  • RSS
  • YouTube
  • Linkedin
  • Facebook