Product Browser

Last updated: 2023/3/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Bulk order
Custom Services
2019 Next Day Shipping

Adipoq (Mouse) Recombinant Protein, Globular 

  • Catalog # : P8398
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse Adipoq (Q60994, 111 a.a. - 247 a.a.) partial-length recombinant protein with His-tag at N-terminal expressed in Escherichia coli .
  • Amount:
  • > 95% by SDS-PAGE
  • Sequence:
  • MAYMYRSAFSVGLETRVTVPNVPIRFTKIFYNQQNHYDGSTGKFYCNIPGLYYFSYHITVYMKDVKVSLFKKDKAVLFTYDQYQEKNVDQASGSVLLHLEVGDQVWLQVYGDGDHNGLYADNVNDSTFTGFLLYHDTN.
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 16
  • Form:
  • Liquid
  • Preparation Method:
  • Escherichia coli expression system
  • Storage Buffer:
  • 20mM Tris-HCl pH7.5, 50mM NaCl, 5mM DTT and 10% Glycerol.
  • Storage Instruction:
  • Store, frozen at -20°C for longer periods of time.
    For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
    Avoid multiple freeze-thaw cycles.
  • Applications
  • SDS-PAGE
  • Application Image
  • SDS-PAGE
  • Gene Information
  • Gene Name:
  • Adipoq
  • Gene Alias:
  • 30kDa,APN,Acdc,Acrp30,GBP28,adipo,apM1
  • Gene Description:
  • adiponectin, C1Q and collagen domain containing
  • Other Designations:
  • adipocyte complement related protein,adipocyte, C1Q and collagen domain containing
  • RSS
  • YouTube
  • Linkedin
  • Facebook