Product Browser

Last updated: 2023/3/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Bulk order
Custom Services
2019 Next Day Shipping

Adipoq (Rat) Recombinant Protein 

  • Catalog # : P8395
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rat Adipoq (Q8K3R4) recombinant protein with FLAG-tag at C-terminal expressed in HEK293 cells.
  • Amount:
  • > 90% by SDS-PAGE
  • Sequence:
  • GITATEGPGALVPPPKETCAGWMAGIPGYPGHNGIPGRDGRDGTPGEKGEKGDAGVLGPKGDPGDAGMTGAEGPRGFPGTPGRKGEPGEAAYMYHSAFSVGLETRVTVPNVPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFSYHITVYMKDVKVSLFKKDKAVLFTYDQYQEKNVDQASGSMLLHLEVGDQVWLQVYGEGDNNGLYADNVNDSTFTGFLLYHDTNAAADYKDDDDK.
  • Host:
  • Human
  • Theoretical MW (kDa):
  • 25.7
  • Form:
  • Lyophilized
  • Preparation Method:
  • HEK 293T cell expression system
  • Storage Buffer:
  • Lyophilized from 20 mM Tris buffer, 50 mM NaCl, pH 7.5.
  • Storage Instruction:
  • Upon reconstitution should be stored at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • SDS-PAGE
  • Application Image
  • SDS-PAGE
  • Gene Information
  • Gene Name:
  • Adipoq
  • Gene Alias:
  • Acdc,Acrp30
  • Gene Description:
  • adiponectin, C1Q and collagen domain containing
  • Other Designations:
  • adipocyte complement related protein of 30 kDa
  • RSS
  • YouTube
  • Linkedin
  • Facebook