Product Browser

Last updated: 2023/3/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Bulk order
Custom Services
2019 Next Day Shipping

Adipoq (Mouse) Recombinant Protein 

  • Catalog # : P8391
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse Adipoq (Q60994) recombinant protein expressed in HEK293 cells.
  • Amount:
  • > 98% by SDS-PAGE
  • Sequence:
  • EDDVTTTEELAPALVPPPKGTCAGWMAGIPGHPGHNGTPGRDGRDGTPGEKGEKGDAGLLGPKGETGDVGMTGAEGPRGFPGTPGRKGEPGEAAYMYRSAFSVGLETRVTVPNVPIRFTKIFYNQQNHYDGSTGKFYCNIPGLYYFSYHITVYMKDVKVSLFKKDKAVLFTYDQYQEKNVDQASGSVLLHLEVGDQVWLQVYGDGDHNGLYADNVNDSTFTGFLLYHDTNDYKDDDDK.
  • Host:
  • Human
  • Theoretical MW (kDa):
  • 26
  • Form:
  • Lyophilized
  • Preparation Method:
  • HEK 293T cell expression system
  • Activity:
  • Full-length adiponectin activates AMP-activated protein kinase in hepatocyte. Adiponectin also activates AMPK in HepG2 human hepatocytes at the concentration of 1.0 ug/mL. An in vitro gluconeogenesis assay which was performed in primary rat hepatocytes showed the murine adiponectin derived from mammalian cells can inhibit glucose production.
  • Particle Size:
  • Full-length adiponec
  • Storage Buffer:
  • Lyophilized from 0.05M PBS buffer,0.075M NaCl, pH7.4.
  • Storage Instruction:
  • Store at -20°C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Gene Name:
  • Adipoq
  • Gene Alias:
  • 30kDa,APN,Acdc,Acrp30,GBP28,adipo,apM1
  • Gene Description:
  • adiponectin, C1Q and collagen domain containing
  • Other Designations:
  • adipocyte complement related protein,adipocyte, C1Q and collagen domain containing
  • RSS
  • YouTube
  • Linkedin
  • Facebook