Product Browser

Last updated: 2023/3/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Bulk order
Custom Services
2019 Next Day Shipping

ADIPOQ (Human) Recombinant Protein,glycosilated, HMW Rich 

  • Catalog # : P8387
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human ADIPOQ (Q15848, 19 a.a. - 244 a.a.) partial-length recombinant protein expressed in HEK293 cells.
  • Amount:
  • > 90% by SDS-PAGE
  • Sequence:
  • ETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN.
  • Host:
  • Human
  • Theoretical MW (kDa):
  • 24.6
  • Form:
  • Lyophilized
  • Preparation Method:
  • HEK 293T cell expression system
  • Storage Buffer:
  • Lyophilized from 20mM Tris, 50mM NaCl, pH 7.5 and 1mM CaCl2.
  • Storage Instruction:
  • Store at -20°C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. Reconstituted protein can be stored at 4°C for a limited period of time.
  • Applications
  • SDS-PAGE
  • Application Image
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 9370
  • Gene Name:
  • ADIPOQ
  • Gene Alias:
  • ACDC,ACRP30,ADPN,APM-1,APM1,GBP28,adiponectin
  • Gene Description:
  • adiponectin, C1Q and collagen domain containing
  • Gene Summary:
  • This gene is expressed in adipose tissue exclusively. It encodes a protein with similarity to collagens X and VIII and complement factor C1q. The encoded protein circulates in the plasma and is involved with metabolic and hormonal processes. [provided by RefSeq
  • Other Designations:
  • adipocyte, C1Q and collagen domain containing,adipocyte, C1Q and collagen domain-containing,adiponectin,adipose most abundant gene transcript 1,gelatin-binding protein 28
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook