Product Browser

Last updated: 2023/3/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Bulk order
Custom Services
2019 Next Day Shipping

INHBB (Human) Recombinant Protein 

  • Catalog # : P8377
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human INHBB (P09529) recombinant protein with His-tag at N-terminal expressed in Nicotiana benthamiana expression system.
  • Amount:
  • > 97% by SDS-PAGE
  • Sequence:
  • HHHHHHHHHHGLECDGRTNLCCRQQFFIDFRLIGWNDWIIAPTGYYGNYCEGSCPAYLAGVPGSASSFHTAVVNQYRMRGLNPGTVNSCCIPTKLSTMSMLYFDDEYNIVKRDVPNMIVEECG.
  • Host:
  • Nicotianab enthamiana
  • Theoretical MW (kDa):
  • 14
  • Form:
  • Lyophilized
  • Preparation Method:
  • Nicotiana benthamiana expression system
  • Particle Size:
  • The biological activ
  • Storage Buffer:
  • Lyophilized from 0.05M Tris-HCl buffer pH 7.4
  • Storage Instruction:
  • Upon reconstitution should be stored at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 3625
  • Gene Name:
  • INHBB
  • Gene Alias:
  • MGC157939
  • Gene Description:
  • inhibin, beta B
  • Gene Summary:
  • The inhibin beta B subunit joins the alpha subunit to form a pituitary FSH secretion inhibitor. Inhibin has been shown to regulate gonadal stromal cell proliferation negatively and to have tumour-suppressor activity. In addition, serum levels of inhibin have been shown to reflect the size of granulosa-cell tumors and can therefore be used as a marker for primary as well as recurrent disease. Because expression in gonadal and various extragonadal tissues may vary severalfold in a tissue-specific fashion, it is proposed that inhibin may be both a growth/differentiation factor and a hormone. Furthermore, the beta B subunit forms a homodimer, activin B, and also joins with the beta A subunit to form a heterodimer, activin AB, both of which stimulate FSH secretion. [provided by RefSeq
  • Other Designations:
  • Inhibin, beta-2,activin AB beta polypeptide,inhibin beta B subunit
  • Interactome
  • Interactome
  • RSS
  • YouTube
  • Linkedin
  • Facebook