Product Browser

Last updated: 2023/3/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

IL1RL1 (Human) Recombinant Protein 

  • Catalog # : P8231
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human IL1RL1 (Q01638, 19 a.a. - 328 a.a.) partial recombinant protein with His tag at C-terminus expressed in Sf9 cells.
  • Sequence:
  • KFSKQSWGLENEALIVRCPRQGKPSYTVDWYYSQTNKSIPTQERNRVFASGQLLKFLPAAVADSGIYTCIVRSPTFNRTGYANVTIYKKQSDCNVPDYLMYSTVSGSEKNSKIYCPTIDLYNWTAPLEWFKNCQALQGSRYRAHKSFLVIDNVMTEDAGDYTCKFIHNENGANYSVTATRSFTVKDEQGFSLFPVIGAPAQNEIKEVEIGKNANLTCSACFGKGTQFLAAVLWQLNGTKITDFGEPRIQQEEGQNQSFSNGLACLDMVLRIADVKEEDLLLQYDCLALNLHGLRRHTVRLSRKNPIDHHSLEHHHHHH
  • Host:
  • insect
  • Theoretical MW (kDa):
  • 36
  • Form:
  • Liquid
  • Preparation Method:
  • Sf9 cell expression system
  • Purity:
  • > 95% by SDS-PAGE
  • Recommend Usage:
  • Biological Activity
    SDS-PAGE
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS pH 7.4 (10% glycerol)
  • Storage Instruction:
  • Store at 2°C to 8°C for 1 week. For long term storage, aliquot and store at -20°C to -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • SDS-PAGE
  • Application Image
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 9173
  • Gene Name:
  • IL1RL1
  • Gene Alias:
  • DER4,FIT-1,MGC32623,ST2,ST2L,ST2V,T1
  • Gene Description:
  • interleukin 1 receptor-like 1
  • Gene Summary:
  • The protein encoded by this gene is a member of the interleukin 1 receptor family. Studies of the similar gene in mouse suggested that this receptor can be induced by proinflammatory stimuli, and may be involved in the function of helper T cells. This gene, interleukin 1 receptor, type I (IL1R1), interleukin 1 receptor, type II (IL1R2) and interleukin 1 receptor-like 2 (IL1RL2) form a cytokine receptor gene cluster in a region mapped to chromosome 2q12. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000161342,growth stimulation-expressed,homolog of mouse growth stimulation-expressed,interleukin 1 receptor-related protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook