Product Browser

Last updated: 2023/3/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

IL1RN (Human) Recombinant Protein 

  • Catalog # : P8228
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human IL1RN (P18510, 25 a.a. - 177 a.a.) partial recombinant protein expressed in Escherichia coli.
  • Sequence:
  • MRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 17
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Purity:
  • > 98% by SDS-PAGE
  • Activity:
  • The ED50 is 0.5 ng/mL as determined by the dose-dependant inhibition of IL-1 stimulation of D10S cells, corresponding to a specific activity of > 2.0 x 106IU/mg.
  • Recommend Usage:
  • Biological Activity
    SDS-PAGE
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • Lyophilized from sterile distilled Water is > 100 ug/mL
  • Storage Instruction:
  • Store at 2°C to 8°C for 1 week. For long term storage, aliquot and store at -20°C to -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 3557
  • Gene Name:
  • IL1RN
  • Gene Alias:
  • ICIL-1RA,IL-1ra3,IL1F3,IL1RA,IRAP,MGC10430
  • Gene Description:
  • interleukin 1 receptor antagonist
  • Gene Summary:
  • The protein encoded by this gene is a member of the interleukin 1 cytokine family. This protein inhibits the activities of interleukin 1, alpha (IL1A) and interleukin 1, beta (IL1B), and modulates a variety of interleukin 1 related immune and inflammatory responses. This gene and five other closely related cytokine genes form a gene cluster spanning approximately 400 kb on chromosome 2. A polymorphism of this gene is reported to be associated with increased risk of osteoporotic fractures and gastric cancer. Four alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq
  • Other Designations:
  • IL1RN (IL1F3),intracellular IL-1 receptor antagonist type II,intracellular interleukin-1 receptor antagonist (icIL-1ra),type II interleukin-1 receptor antagonist
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook