Product Browser

Last updated: 2023/3/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

IL1B (Human) Recombinant Protein 

  • Catalog # : P8219
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human IL1B (P01584, 117 a.a. - 269 a.a.) partial recombinant protein expressed in HEK293 cells.
  • Sequence:
  • APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIP VALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFES AQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
  • Host:
  • Mammals
  • Theoretical MW (kDa):
  • 18-25
  • Form:
  • Lyophilized
  • Preparation Method:
  • Mammalian cell (HEK293) expression system
  • Purity:
  • > 95% by SDS-PAGE
  • Recommend Usage:
  • Biological Activity
    SDS-PAGE
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In sterile PBS containing 0.1% endotoxin-free recombinant HSA.
  • Storage Instruction:
  • Store at 2°C to 8°C for 1 week. For long term storage, aliquot and store at -20°C to -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 3553
  • Gene Name:
  • IL1B
  • Gene Alias:
  • IL-1,IL1-BETA,IL1F2
  • Gene Description:
  • interleukin 1, beta
  • Gene Summary:
  • The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine is produced by activated macrophages as a proprotein, which is proteolytically processed to its active form by caspase 1 (CASP1/ICE). This cytokine is an important mediator of the inflammatory response, and is involved in a variety of cellular activities, including cell proliferation, differentiation, and apoptosis. The induction of cyclooxygenase-2 (PTGS2/COX2) by this cytokine in the central nervous system (CNS) is found to contribute to inflammatory pain hypersensitivity. This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. [provided by RefSeq
  • Other Designations:
  • catabolin,preinterleukin 1 beta,pro-interleukin-1-beta
  • Interactome
  • Interactome
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook