Product Browser

Last updated: 2023/3/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Bulk order
Custom Services
2019 Next Day Shipping

Il1a (Rat) Recombinant Protein 

  • Catalog # : P8212
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rat Il1a (P16598, 115 a.a. - 270 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.
  • Sequence:
  • MGSSHHHHHHSSGLVPRGSHMGSSAPHSFQNNLRYKLIRIVKQEFIMNDSLNQNIYVDMDRIHLKAASLNDLQLEVKFDMYAYSSGGDDSKYPVTLKVSNTQLFVSAQGEDKPVLLKEIPETPKLITGSETDLIFFWEKINSKNYFTSAAFPELLIATKEQSQVHLARGLPSMIDFQIS
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 20.2
  • Form:
  • Liquid
  • Preparation Method:
  • Escherichia coli expression system
  • Purity:
  • > 95% by SDS-PAGE
  • Activity:
  • The ED50 is < 20 pg/mL as determined in a cell proliferation assay using D10.G4.1 mouse helper T cells.
  • Recommend Usage:
  • Biological Activity
    SDS-PAGE
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS pH 7.4 (10% glycerol)
  • Storage Instruction:
  • Store at 2°C to 8°C for 1 week. For long term storage, aliquot and store at -20°C to -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Gene Name:
  • Il1a
  • Gene Alias:
  • IL-1 alpha
  • Gene Description:
  • interleukin 1 alpha
  • Other Designations:
  • interleukin-1 alpha
  • RSS
  • YouTube
  • Linkedin
  • Facebook