Product Browser

Last updated: 2023/3/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

IL1A (Human) Recombinant Protein 

  • Catalog # : P8205
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human IL1A (P01583, 113 a.a. - 271 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.
  • Sequence:
  • HHHHHHSAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILENQA
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 22.5
  • Form:
  • Liquid
  • Preparation Method:
  • Escherichia coli expression system
  • Purity:
  • > 95% by SDS-PAGE
  • Recommend Usage:
  • Biological Activity
    SDS-PAGE
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In 1X PBS (50% glycerol)
  • Storage Instruction:
  • Store at 2°C to 8°C for 1 week. For long term storage, aliquot and store at -20°C to -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • SDS-PAGE
  • Application Image
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 3552
  • Gene Name:
  • IL1A
  • Gene Alias:
  • IL-1A,IL1,IL1-ALPHA,IL1F1
  • Gene Description:
  • interleukin 1, alpha
  • Gene Summary:
  • The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine is a pleiotropic cytokine involved in various immune responses, inflammatory processes, and hematopoiesis. This cytokine is produced by monocytes and macrophages as a proprotein, which is proteolytically processed and released in response to cell injury, and thus induces apoptosis. This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. It has been suggested that the polymorphism of these genes is associated with rheumatoid arthritis and Alzheimer's disease. [provided by RefSeq
  • Other Designations:
  • IL1A (IL1F1),hematopoietin-1,preinterleukin 1 alpha,pro-interleukin-1-alpha
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook