Product Browser

Last updated: 2023/3/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

IGFBP6 (Human) Recombinant Protein 

  • Catalog # : P8197
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human IGFBP6 (P24592, 148 a.a. - 240 a.a.) partial recombinant protein with His tag expressed in Escherichia coli.
  • Sequence:
  • SQPNSAGVQDTEMGPCRRHLDSVLQQLQTEVYRGAQTLYVPNCDHRGFYRKRQCRSSQGQRRGPCWCVDRMGKSLPGSPDGNGSSSCPTGSSG
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 20
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Purity:
  • > 80% by SDS-PAGE
  • Recommend Usage:
  • Biological Activity
    SDS-PAGE
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • Lyophilized from sterile distilled Water is > 100 ug/mL
  • Storage Instruction:
  • Store at 2°C to 8°C for 1 week. For long term storage, aliquot and store at -20°C to -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • SDS-PAGE
  • Application Image
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 3489
  • Gene Name:
  • IGFBP6
  • Gene Alias:
  • IBP6
  • Gene Description:
  • insulin-like growth factor binding protein 6
  • Other Designations:
  • IGF binding protein 6
  • RSS
  • YouTube
  • Linkedin
  • Facebook