Product Browser

Last updated: 2023/3/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Bulk order
Custom Services
2019 Next Day Shipping

IGFBP1 (Human) Recombinant Protein 

  • Catalog # : P8191
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human IGFBP1 (P08833, 26 a.a. - 259 a.a.) partial recombinant protein expressed in Mouse myeloma cell line.
  • Sequence:
  • APWQCAPCSAEKLALCPPVSASCSEVTRSAGCGCCPMCALPLGAACGVATARCARGLSCRALPGEQQPLHALTRGQGACVQESDASAPHAAEAGSPESPESTEITEEELLDNFHLMAPSEEDHSILWDAISTYDGSKALHVTNIKKWKEPCRIELYRVVESLAKAQETSGEEISKFYLPNCNKNGFYHSRQCETSMDGEAGLCWCVYPWNGKRIPGSPEIRGDPNCQIYFNVQN
  • Host:
  • Mouse
  • Theoretical MW (kDa):
  • 25
  • Form:
  • Lyophilized
  • Preparation Method:
  • Mouse myeloma cell line,NS0 expression system
  • Purity:
  • > 95% by SDS-PAGE
  • Activity:
  • The ED50 as determined bythe inhibition of rHuIGF-I-induced proliferation of human MCF-7 cells is < 4 ug/mL.
  • Recommend Usage:
  • Biological Activity
    SDS-PAGE
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • Lyophilized from sterile distilled Water is > 100 ug/mL
  • Storage Instruction:
  • Store at 2°C to 8°C for 1 week. For long term storage, aliquot and store at -20°C to -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 3484
  • Gene Name:
  • IGFBP1
  • Gene Alias:
  • AFBP,IBP1,IGF-BP25,PP12,hIGFBP-1
  • Gene Description:
  • insulin-like growth factor binding protein 1
  • Gene Summary:
  • This gene is a member of the insulin-like growth factor binding protein (IGFBP) family and encodes a protein with an IGFBP domain and a thyroglobulin type-I domain. The protein binds both insulin-like growth factors (IGFs) I and II and circulates in the plasma. Binding of this protein prolongs the half-life of the IGFs and alters their interaction with cell surface receptors. [provided by RefSeq
  • Other Designations:
  • IGF-binding protein 1,alpha-pregnancy-associated endometrial globulin,amniotic fluid binding protein,binding protein-25,binding protein-26,binding protein-28,growth hormone independent-binding protein,placental protein 12
  • RSS
  • YouTube
  • Linkedin
  • Facebook