Product Browser

Last updated: 2023/3/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Bulk order
Custom Services
2019 Next Day Shipping

IGF2 (Human) Recombinant Protein 

  • Catalog # : P8188
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human IGF2 (P01344, 25 a.a. - 91 a.a.) partial recombinant protein expressed in Escherichia coli.
  • Sequence:
  • AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSE
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 7.5
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Purity:
  • > 95% by SDS-PAGE
  • Activity:
  • The activity is determined by the dose-dependent proliferation of FDC-P1 cells and is typically 8.39ng/mL corresponding to a specific activity of 1.2x105 units/mg.
  • Recommend Usage:
  • Biological Activity
    SDS-PAGE
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • Lyophilized from sterile distilled Water is > 100 ug/mL
  • Storage Instruction:
  • Store at 2°C to 8°C for 1 week. For long term storage, aliquot and store at -20°C to -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 3481
  • Gene Name:
  • IGF2
  • Gene Alias:
  • C11orf43,FLJ22066,FLJ44734,INSIGF,pp9974
  • Gene Description:
  • insulin-like growth factor 2 (somatomedin A)
  • Gene Summary:
  • This gene encodes a member of the insulin family of polypeptide growth factors that is involved in development and growth. It is an imprinted gene and is expressed only from the paternally inherited allele. It is a candidate gene for eating disorders. There is a read-through, INS-IGF2, which aligns to this gene at the 3' region and to the upstream INS gene at the 5' region. Alternatively spliced transcript variants, encoding either the same or different isoform, have been found for this gene. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000011012,OTTHUMP00000011015,OTTHUMP00000011018,OTTHUMP00000011157,insulin-like growth factor 2,insulin-like growth factor II,insulin-like growth factor type 2,putative insulin-like growth factor II associated protein,somatomedin A
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook