Product Browser

Last updated: 2023/3/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Bulk order
Custom Services
2019 Next Day Shipping

IGF1 (Rabit) Recombinant Protein 

  • Catalog # : P8187
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabit IGF1 (Q95222, 4 a.a. - 70 a.a.) partial recombinant protein expressed in Escherichia coli.
  • Sequence:
  • MTAGPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKP
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 7.6
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Purity:
  • > 98% by SDS-PAGE
  • Activity:
  • The ED50?is 5 - 25 ng/mL, calculated by the dose -dependent proliferation of human MCF/7 cells in the cell culture mixture dependent on culture conditions. ts activity consists of 30-40 % compared to human IGF-1.
  • Recommend Usage:
  • Biological Activity
    SDS-PAGE
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • Lyophilized from sterile 0.4% NaHCO3, pH 8-9 > 100 ug/mL
  • Storage Instruction:
  • Store at 2°C to 8°C for 1 week. For long term storage, aliquot and store at -20°C to -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Gene Name:
  • IGF-IB
  • Gene Alias:
  • -
  • Gene Description:
  • insulin-like growth factor IB
  • Other Designations:
  • -
  • RSS
  • YouTube
  • Linkedin
  • Facebook