Product Browser

Last updated: 2023/3/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

Igf1 (Rat) Recombinant Protein 

  • Catalog # : P8185
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rat Igf1 (P08025, 49 a.a. - 118 a.a.) partial recombinant protein expressed in Escherichia coli.
  • Sequence:
  • GPETLCGAELVDALQFVCGPRGFYFNKPTGYGSSIRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPTKSA
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 7.7
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Purity:
  • > 98% by SDS-PAGE
  • Activity:
  • The ED50 as determined by a cell proliferation assay using FDC-P1 cells is < 2.0 ng/mL, corresponding to a specific activity of > 5.0 x 105 units/mg.
  • Recommend Usage:
  • Biological Activity
    SDS-PAGE
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • Lyophilized from sterile distilled Water is > 100 ug/mL
  • Storage Instruction:
  • Store at 2°C to 8°C for 1 week. For long term storage, aliquot and store at -20°C to -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Gene Name:
  • Igf1
  • Gene Alias:
  • -
  • Gene Description:
  • insulin-like growth factor 1
  • Other Designations:
  • Insulin-like growth factor I,somatomedin
  • RSS
  • YouTube
  • Linkedin
  • Facebook